Phosphatidylinositol-specific phospholipase C from Bacillus thuringiensis
Enzyme Description
Sequence
MSNKKLILKLFICSTIFITFVFALHDKRVVAASSVNELENWSKWMQPIPDNIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEGSFSSTFEKNYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNESGGYNNFYWPDNETFTTTVNQNVNVTVQDKYKVNYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANDIKQKNPTRVGWVIQDYINEKWSPLLYQEVIRANKSLIKE
Yiqin Wu et al. (1997)
β Phosphatidylinositol-Specific Phospholipase C Cyclic Phosphodiesterase Activity Depends on Solvent Polarity
▼
Database ID
UniProt: P08954 β
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Bacillus subtilis BG2320
Experimental Data (27 measurements)
27 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Isopropanol | 20% | 0.0 | 22.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 55% | 0.0 | 56.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50% | 0.0 | 61.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 45% | 0.0 | 60.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 40% | 0.0 | 50.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 0.0 | 28.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20% | 0.0 | 7.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 0.0 | 3.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 50% | 0.0 | 34.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 40% | 0.0 | 44.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 30% | 0.0 | 28.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 20% | 0.0 | 11.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 10% | 0.0 | 3.5 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Isopropanol | 40% | 0.0 | 33.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Isopropanol | 35% | 0.0 | 38.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Isopropanol | 30% | 0.0 | 47.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Isopropanol | 10% | 0.0 | 3.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Classical | Activity (in Β΅mols/(min*mg), measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 45% | 0.0 | 40.0 | Β΅mols/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 10 mM 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in micromols/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Michaelis-Menten | Vmax/Km (in mL/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50% | 0.22 | 18.0 | mL/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in mL/(min*mg)) | EC number not the one indicated in UniProt or the article |
| Activity - Michaelis-Menten | Vmax/Km (in mL/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 40% | 0.22 | 9.4 | mL/(min*mg) | 50 mM Hepes buffer | 7.5 | 30Β°C | 1D-myo-inositol 1,2-cyclic phosphate | D-myo inositol 1-phosphate | β | β | Classical aqueous control (in mL/(min*mg)) | EC number not the one indicated in UniProt or the article |
Visualization : Activity β Classical
Yiqin Wu et al. (1997)
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Activity β Michaelis-Menten
Yiqin Wu et al. (1997)
One bar per measurement. Colour = solvent, shade = solvent volume.
Hania Wehbi et al. (2003)
β Water-miscible organic cosolvents enhance phosphatidylinositol-specific phospholipase C phosphotransferase as well as phosphodiesterase activity
Biochimica et Biophysica Acta (BBA) - Biomembranes
Β· doi:10.1016/s0005-2736(03)00134-2 β
Β· Activity - Classical
▼
Database ID
UniProt: P08954 β
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium MM294
Experimental Data (31 measurements)
31 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50% | 0 | 61 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 8 mM inositol 1,2-(cyclic)-phosphate | Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 60% | 0 | 122 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50% | 0 | 324 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 40% | 0 | 238 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 0 | 147 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20% | 0 | 98 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 50% | 0 | 66 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 40% | 0 | 198 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 30% | 0 | 297 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethylformamide (DMF) | 20% | 0 | 145 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Isopropanol | 50% | 0 | 152 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Isopropanol | 40% | 0 | 514 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Isopropanol | 30% | 0 | 558 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Isopropanol | 20% | 0 | 328 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Isopropanol | 10% | 0 | 188 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 6 mM PI SUVs (phosphatidylinositol small unilamellar vesicles) | diacylglycerol , Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 55% | 0 | 56 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 8 mM inositol 1,2-(cyclic)-phosphate | Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Isopropanol | 10% | 0 | 4 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 8 mM inositol 1,2-(cyclic)-phosphate | Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 47.5% | 0 | 60 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 8 mM inositol 1,2-(cyclic)-phosphate | Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 40% | 0 | 50 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 8 mM inositol 1,2-(cyclic)-phosphate | Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
| Activity - Classical | Activity (in Β΅mol/(min*mg)) measured by 31P NMR in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20% | 0 | 7 | Β΅mol/(min*mg) | 25 mM HEPES | 7.5 | Room temperature | 8 mM inositol 1,2-(cyclic)-phosphate | Inositol 1-phosphate | β | β | Classical aqueous control (in micromol/(min*mg)) |
Visualization : Activity β Classical
Hania Wehbi et al. (2003)
One bar per measurement. Colour = solvent, shade = solvent volume.