Esterase (gene AhEst) from Acetomicrobium hydrogeniforman

Enzyme Description

Species

Acetomicrobium hydrogeniforman ↗

Extremophile

Yes "thermophilic" organism

EC Number

3.1.1.1 ↗

Sequence

Length: 280 amino acids

MMSDKGISIAFATICLFLIVALLPGLAGTNPLLQRAEGAQTLKEEIITYNHEDTVLEGYLVYEESVKDKRPGVIIIHEWMGLSEYEKMRARQIAELGYVAFAADIYGKGVRPKNADEAAQLAGKFRSDRNLLRERGQAALSVLQNHPLVDPERIATMGYCFGGGASLELARSGAPIRGAISFHGNLDTPNPDDAKNIKGSILVLHGADDPMVPMEQVIAFQEEMRSANVDWQMIFYGNTVHSFTNPNAGNNPEIGVAYNPISERRSFEAMKAFFDEIFAK

Patricia S. Kumagai et al. (2018) — Characterization of esterase activity from an Acetomicrobium hydrogeniformans enzyme with high structural stability in extreme conditions

Extremophiles · doi:10.1007/s00792-018-1038-3 ↗ · Activity + Stability - Incubation

9 measurements ▼

Database ID

UniProt: A0A0T5X9X1 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli Rosetta (DE3)

Experimental Data (9 measurements)

9 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	10%	100	92	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	20%	100	82	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	30%	100	55	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Propanol	10%	100	87	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Propanol	20%	100	71	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Propanol	30%	100	42	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	10%	100	87	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	20%	100	62	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	30%	100	39	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer

Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	10%	100	92	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	20%	100	82	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	30%	100	55	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Propanol	10%	100	87	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Propanol	20%	100	71	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Propanol	30%	100	42	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	10%	100	87	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	20%	100	62	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer
Activity + Stability - Incubation	Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	30%	100	39	%	Incubation: ? mM sodium phosphate buffer, Assay: ? mM sodium phosphate buffer	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 65°C	0.125 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in the presence of organic solvent \| pH deducted from the buffer

Visualization : Activity + Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*