Esterase (gene estA) from Enterobacter cloacae

Enzyme Description

Extremophile
No but"cold-adapted" enzyme
EC Number

Sequence

Length: 238 amino acids
MIEIEIRRLGDHEILHATPTGKRDKPLPVVVFYHGFTSSKLVYSYFAVALAQAGFRVVMPDAPDHGVRFTGDEQARLGQFWPILHGSLTEFSGLRDALYDAGLVADNRLAVAGASMGGMTALGIMTHHPEVRSVACLMGSGYFTSLAKTLFPPQDLTEMTARLADWEVTRALPRVADRPLLLWHGDADDVVPPDGTFRLQQALKREGLDGNLTCLWESGVRHRITPAALEATVAFFRQ
Mengmeng Ke et al. (2018) β€” Engineering and characterization of a novel low temperature active and thermo stable esterase from marine Enterobacter cloacae
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2018.05.193 β†—  Β· Activity - Classical
18 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (18 measurements)

18 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100.0 106.4 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethylene Glycol 30% 100.0 11.2 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30% 100.0 62.6 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100.0 111.6 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30% 100.0 74.2 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 30% 100.0 21.7 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 30% 100.0 35.5 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethylene Glycol 20% 100.0 20.0 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 20% 100.0 102.2 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 10% 100.0 97.3 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 20% 100.0 100.6 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 20% 100.0 85.4 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 20% 100.0 93.8 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethylene Glycol 10% 100.0 24.1 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 10% 100.0 105.6 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100.0 99.4 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 10% 100.0 114.3 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 10% 100.0 107.3 % phosphate-citrate buffer 9 25Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*