Esterase (gene estA) from Enterobacter cloacae
Enzyme Description
Sequence
MIEIEIRRLGDHEILHATPTGKRDKPLPVVVFYHGFTSSKLVYSYFAVALAQAGFRVVMPDAPDHGVRFTGDEQARLGQFWPILHGSLTEFSGLRDALYDAGLVADNRLAVAGASMGGMTALGIMTHHPEVRSVACLMGSGYFTSLAKTLFPPQDLTEMTARLADWEVTRALPRVADRPLLLWHGDADDVVPPDGTFRLQQALKREGLDGNLTCLWESGVRHRITPAALEATVAFFRQ
Mengmeng Ke et al. (2018)
β Engineering and characterization of a novel low temperature active and thermo stable esterase from marine Enterobacter cloacae
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2018.05.193 β
Β· Activity - Classical
▼
Database ID
UniProt: A0ABX9F5R3 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (18 measurements)
18 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20% | 100.0 | 106.4 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethylene Glycol | 30% | 100.0 | 11.2 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30% | 100.0 | 62.6 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 111.6 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 30% | 100.0 | 74.2 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 30% | 100.0 | 21.7 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 30% | 100.0 | 35.5 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethylene Glycol | 20% | 100.0 | 20.0 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 20% | 100.0 | 102.2 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 10% | 100.0 | 97.3 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 20% | 100.0 | 100.6 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 20% | 100.0 | 85.4 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 20% | 100.0 | 93.8 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethylene Glycol | 10% | 100.0 | 24.1 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 10% | 100.0 | 105.6 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100.0 | 99.4 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 10% | 100.0 | 114.3 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 10% | 100.0 | 107.3 | % | phosphate-citrate buffer | 9 | 25Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.