3-hydroxy-3-methylglutaryl coenzyme A reductase from Sulfolobus solfataricus

Enzyme Description

Extremophile
Yes "thermoacidophilic" organism
EC Number

Sequence

Length: 409 amino acids
MKIDEVVEKLVKGEISFHEVDNLLEANAAMVARRLALEKIVGVGLPSIGSTVIDYSEIKNKNAENVIGAIQIPLGIVGPIRVNGDYAKGDFYVPMATTEGALIASVNRGIKAVTLSGGVRAKVLKDEMTRAPVFKFDSIEQIPNFLKFIEENLEKIRNIANSTSHHGKLKSITPFVLGNNVWLRFSFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVVAEALIKKDVIRNILHSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQDVAQIVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPPGSNAKKLAEIIASTVLSGELNLLAALSNKELGKAHAKLGRAMKV
Michael Dirkmann et al. (2017) β€” A Multiperspective Approach to Solvent Regulation of Enzymatic Activity: HMG-CoA Reductase
ChemBioChem  Β· doi:10.1002/cbic.201700596 β†—  Β· Activity - Classical
79 measurements
Database ID
UniProt: O08424 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta‐gamiTM 2(DE3)

Experimental Data (79 measurements)

79 measurements β€” page 1 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 30% 100 59 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 20% 100 66 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 15% 100 80 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 10% 100 85 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 5% 100 93 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 2.5% 100 98 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 1% 100 100 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 60% 100 12 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 50% 100 26 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 40% 100 50 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 30% 100 51 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 20% 100 79 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 15% 100 86 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 10% 100 90 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 5% 100 95 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Ethanol 2.5% 100 96 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Methanol 60% 100 17 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Methanol 50% 100 29 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Methanol 40% 100 48 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Methanol 30% 100 57 % 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
β€Ή Prev
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*