Esterase (gene est-OKK) from a deep-sea hydrothermal vent metagenomic library

Enzyme Description

Species

Na (deep-sea hydrothermal vent metagenomic library)

Extremophile

Yes likely extremophilic organism (for hydrothermal vent), "alkali-stable" and "halo-stable" enzyme

EC Number

3.1.1.1 ↗

Sequence

Length: 269 amino acids

MLELFFRKKGESGEPLIILHGLYGSGDNWISIANELKDYFQVYLIDQRNHGRSPHADDMSYESMAEDLHEFIKSQNLESVNIIGHSMGGKTAMWFTAAHPDKVKKLIVADIAPGKYDTTSPNVKTHKKIIAALKSIDPSEAKTRKEIETQLSRYIDNVQLRMFLLKNIERKEDGCYRWKINIDSIEKNIINIMSGITGIDIPVHVPALFLKGELSDYITDKDIPLIKEIFPDAKLVTIPGAGHWLHAQQPKIFIQKTLEFLRNRKTVDR

Xinwei Yang et al. (2018) — Identification and characterization of a novel alkalistable and salt-tolerant esterase from the deep-sea hydrothermal vent of the East Pacific Rise

MicrobiologyOpen · doi:10.1002/mbo3.601 ↗ · Stability - Incubation

5 measurements ▼

Database ID

UniParc: UPI000D543818 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (5 measurements)

5 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Methanol	20%	100.0	89.6	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	20%	100.0	74.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	20%	100.0	116.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Isopropanol	20%	100.0	98.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	20%	100.0	39.9	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control

Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Methanol	20%	100.0	89.6	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	20%	100.0	74.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	20%	100.0	116.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Isopropanol	20%	100.0	98.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	20%	100.0	39.9	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 9	Incubation: Room temperature, Assay: 50°C	? mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*