Protease from Pseudomonas aeruginosa PST-01
Enzyme Description
Sequence
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL
Hiroyasu Ogino et al. (1996)
β An Organic Solvent-tolerant Bacterium and Its Organic Solvent-stable Protease
Annals of the New York Academy of Sciences
Β· doi:10.1111/j.1749-6632.1996.tb33218.x β
Β· Stability - Incubation
▼
Database ID
UniProt: P14756 β
Sequence Annotation
Inferred - from protein name (197 first residues from UniProt sequence removed from mature protein, as documented in 10.1016/s1369-703x(00)00060-7)
Protein Source
Purified, bacterium Pseudomonas aeruginosa
Experimental Data (20 measurements)
20 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | 1-Decanol | 23% | 100 | 123 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | 1-Hexanol | 23% | 100 | 168 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | Ethanol | 23% | 100 | 155 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | Methanol | 23% | 100 | 154 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | 1-Heptanol | 23% | 100 | 152 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | Dimethyl Sulfoxide (DMSO) | 23% | 100 | 152 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | Isopropanol | 23% | 100 | 143 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | 1-Butanol | 23% | 100 | 143 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | 1-Octanol | 23% | 100 | 140 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | Acetone | 23% | 100 | 132 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | n-Heptane | 23% | 100 | 46 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | n-Decane | 23% | 100 | 98 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | Toluene | 23% | 100 | 96 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | p-Xylene | 23% | 100 | 88 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | n-Octane | 23% | 100 | 86 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | Benzene | 23% | 100 | 70 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | Isooctane | 23% | 100 | 68 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | n-Dodecane | 23% | 100 | 66 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | n-Hexane | 23% | 100 | 56 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (10 days at 30Β°C) measured by absorbance spectrophotometry in aqueous phase | Cyclohexane | 23% | 100 | 54 | % | Incubation: ?, Assay: ? | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
Visualization : Stability β Incubation
Hiroyasu Ogino et al. (1996)
One bar per measurement. Colour = solvent, shade = solvent volume.
Hiroyasu Ogino et al. (1999)
β Purification and characterization of organic solvent-stable protease from organic solvent-tolerant Pseudomonas aeruginosa PST-01
Journal of Bioscience and Bioengineering
Β· doi:10.1016/s1389-1723(99)80009-7 β
Β· Stability - Half-life
▼
Database ID
UniProt: P14756 β
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, bacterium Pseudomonas aeruginosa PST-01
Experimental Data (24 measurements)
24 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1-Octanol | 25% | 9.1 | 24.2 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Cyclohexane | 25% | 9.1 | 2.3 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | n-Decane | 25% | 9.1 | 2.4 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | n-Hexane | 25% | 9.1 | 3.8 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | p-Xylene | 25% | 9.1 | 4.4 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | n-Heptane | 25% | 9.1 | 4.8 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Benzene | 25% | 9.1 | 7.8 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Toluene | 25% | 9.1 | 12.0 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1,4-Dioxane | 25% | 9.1 | 11.7 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1-Decanol | 25% | 9.1 | 19.4 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Acetone | 25% | 9.1 | 23.1 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1-Butanol | 25% | 9.1 | 24.2 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Ethylene Glycol | 25% | 9.1 | >100.0 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Dimethylformamide (DMF) | 25% | 9.1 | 25.3 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1-Heptanol | 25% | 9.1 | >50.0 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | tert-Butanol | 25% | 9.1 | >55.0 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Triethylene Glycol | 25% | 9.1 | >54.0 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Isopropanol | 25% | 9.1 | >53.0 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 25% | 9.1 | >52.0 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Methanol | 25% | 9.1 | >51.0 | days | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
Visualization : Stability β Half-life
Hiroyasu Ogino et al. (1999)
One bar per measurement. Colour = solvent, shade = solvent volume.
Hiroyasu Ogino et al. (2007)
β Stabilities and Conformational Transitions of Various Proteases in the Presence of an Organic Solvent
Biotechnology Progress
Β· doi:10.1021/bp060252p β
Β· Stability - Half-life
▼
Database ID
UniProt: P14756 β
Sequence Annotation
Inferred - from protein name (197 first residues from UniProt sequence absent from the mature protein)
Protein Source
Purified, bacterium Pseudomonas aeruginosa PST-01
Experimental Data (1 measurement)
1 measurement
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Half-life | Half-life (in hours) at 30Β°C measured using absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) | Methanol | 25% | 244 | 984 | hours | Incubation: 10 mM sodium phosphate buffer, Assay: 50 mM borax-HCl | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | β | Classical aqueous control (in hours) |
Visualization : Stability β Half-life
Hiroyasu Ogino et al. (2007)
One bar per measurement. Colour = solvent, shade = solvent volume.