Protease (gene SAPHM) from Bacillus licheniformis K7A

Enzyme Description

Species
Bacillus licheniformis K7A β†—
Extremophile
Yes "thermophilic" organism, "alkaline" enzyme
EC Number
3.4.- β†—

Sequence

Length: 274 amino acids
AQTVPQGIPLIKAEKVQAQGFDGARVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAETVAALDNTTGVLGVAPSVSLYAVKVLNSSWSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGKSGSSGNTNTIGYPAKYDSVIAVGAVKSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPRLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Raziqa Hadjidj et al. (2018) β€” Purification, biochemical, and molecular characterization of novel protease from Bacillus licheniformis strain K7A
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2018.03.167 β†—  Β· Stability - Incubation
19 measurements ▼
Database ID
UniProt: A0A345FZ45 β†—
Sequence Annotation
Explicit - Provided (105 first residues removed from mature protein sequence)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3) pLysS

Experimental Data (19 measurements)

19 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase 1-Hexanol 50% 100 75 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 57 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Dimethylformamide (DMF) 50% 100 325 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Methanol 50% 100 53 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Ethanol 50% 100 18 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Acetonitrile 50% 100 30 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Isopropanol 50% 100 88 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Isopropanol 50% 100 61 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Ethyl Acetate 50% 100 160 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase 1-Butanol 50% 100 94 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Hexadecane 50% 100 90 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Chloroform 50% 100 243 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Benzene 50% 100 90 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Toluene 50% 100 81 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Cyclohexane 50% 100 185 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Hexane 50% 100 106 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Heptane 50% 100 120 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Isooctane 50% 100 99 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Decane 50% 100 76 % Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 70Β°C 1% Casein free amino acids , Peptides β€” Incubation: 200 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*