Laccase (gene CtLac) from Caldalkalibacillus thermarum TA2.A1
Enzyme Description
Extremophile
Yes
"thermoalkaliphilic" organism
EC Number
Sequence
MKRILTLVLLLTVFIIVLVGCSTSPVDHSKMVHGEDDSTDNKQQEETQQIETSEGKVVINLEAKVTHWMFNNDLMEDIWTYNGSLPGQEIRVQEGDHVVINLTNSLDVPTSLHLHGVPVPNEMDGVPGVTQNAIMPGETFTYEFVADTPGTYWYHSHQDGANQIGMGLYGALVVEHKDQPDYDLDQVIMIDEWSSMGMADMDHSGMDHGDHGNMGDNSDQPPHAEMMNMMYDTLIVNGKASPVIEAIGVSEDDTIKLRFVNTGLFTQVITIPGHEFKVTHYDGQQVNEPELISDTAIRIAPAERYDVEIEMNQPGAWGIQIYAEENENLRGIVPLVYAGFEDEELQTADSIQSFLDISAYGSPMNVNFGEITKEFDMILGSDDGGETFTINGKQMTTKGFESHEDHEIYEVEEGDVVKVNIVNDTDVDHPMHLHGHFFYVVSRNGQPVKGSPILKETLNVRPNEAYEIVFVADNPGHWMFHCHELHHASGGMVSEVRYSGYTPAFTPDPNIPNKPE
Sunil Ghatge et al. (2018)
β A novel laccase from thermoalkaliphilic bacterium Caldalkalibacillus thermarum strain TA2.A1 able to catalyze dimerization of a lignin model compound
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-018-8898-4 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI00020F0D7F β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Acetone | 10% | 100 | 117 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Acetone | 30% | 100 | 34 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Acetone | 50% | 100 | 0 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Acetonitrile | 10% | 100 | 101 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Acetonitrile | 30% | 100 | 71 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Acetonitrile | 50% | 100 | 32 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100 | 131 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100 | 80 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50% | 100 | 23 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Ethanol | 10% | 100 | 152 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Ethanol | 30% | 100 | 84 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Ethanol | 50% | 100 | 20 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Methanol | 10% | 100 | 140 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Methanol | 30% | 100 | 83 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical absorbance measurement, 420 nm) in the presence of organic solvent | Methanol | 50% | 100 | 39 | % | 50 mM citrate-phosphate | 8 | 37Β°C | 0.5 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 1 mM CuCl2 | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.