Esterase (gene e69) from Erythrobacter seohaensis SW-135

Enzyme Description

Species
Erythrobacter seohaensis SW-135 β†—
Extremophile
No but "halotolerant" and "thermoalkalophilic" enzyme
EC Number
3.1.1.1 β†—

Sequence

Length: 274 amino acids
MRDHGERFVVEAEERRTVSIERTNLGGVNIAWVSPSDKVPSSDGPLIFNLHDGGFALNDGDAALYTAVSFAELQQLDSVSVDYRLTPQHPYPAALEDAVAAYAVIKRKMPGRPIVVYGLSAGGGLGAAFLLKVKQLGLPMPEAAVLNSPWSDVSMNSDTLATLDCYDPLLGGSRPTLKPLANSYAAGADPQDPLVSPVYGDWEGVDVPVLLISGTRDVMLGDTVRLHRAMWRAGVPAELIVNEGMWHAFSVEPEFEAMIADSARFIRHISAKED
Ying-Yi Huo et al. (2017) β€” A Novel Halotolerant Thermoalkaliphilic Esterase from Marine Bacterium Erythrobacter seohaensis SW-135
Frontiers in Microbiology  Β· doi:10.3389/fmicb.2017.02315 β†—  Β· Activity - Classical
16 measurements ▼
Database ID
UniParc: UPI000CA3B563 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (16 measurements)

16 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 5% 100.0 59.6 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 5% 100.0 85.4 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 5% 100.0 90.3 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 5% 100.0 74.8 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100.0 42.1 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Glycerol 5% 100.0 121.7 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 5% 100.0 91.3 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 5% 100.0 0.0 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 15% 100.0 8.9 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 15% 100.0 35.0 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 15% 100.0 13.9 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 15% 100.0 17.1 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100.0 30.3 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Glycerol 15% 100.0 0.0 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 15% 100.0 28.8 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 15% 100.0 0.0 % 50 mM CHES buffer 10 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*