GH134 Ξ²-1,4-mannanase SsGH134 from Streptomyces sp. NRRL B-24484

Enzyme Description

Extremophile
No but "thermostable" and "pH-tolerant" enzyme
EC Number

Sequence

Length: 213 amino acids
ETAPNGYPYCANGSASDPDGDGWGWENNRSCVVRTGSGSGSGSGSSACPSGATCGSYTVGGLGSRKQQVRNAGGSSLDLAVAMLETERMDTAYPYGDNKSGDAANFGIFKQNWLMLRSACAQFGGQGAGQYDNGAALNSSLGQDVSCLHQSQSHYGLDAWFAGHRNGASGLSSPNTADIAAYKAAVYWIKAQLDADSANLGNDTRFWVQVPAI
Kiyota Sakai et al. (2018) β€” Characterization of pH-tolerant and thermostable GH 134 Ξ²-1,4-mannanase SsGH134 possessing carbohydrate binding module 10 from Streptomyces sp. NRRL B-24484
Journal of Bioscience and Bioengineering  Β· doi:10.1016/j.jbiosc.2017.10.009 β†—  Β· Stability - Incubation
4 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number (28 first residues from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (4 measurements)

4 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (DNS assay) in aqueous phase Methanol 20% 100 78 % ? Incubation: 6, Assay: ? Incubation: 30Β°C, Assay: 37Β°C 0.5% (w/v) Glucomannan Reducing sugars β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (DNS assay) in aqueous phase Ethanol 20% 100 85 % ? Incubation: 6, Assay: ? Incubation: 30Β°C, Assay: 37Β°C 0.5% (w/v) Glucomannan Reducing sugars β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (DNS assay) in aqueous phase Isopropanol 20% 100 65 % ? Incubation: 6, Assay: ? Incubation: 30Β°C, Assay: 37Β°C 0.5% (w/v) Glucomannan Reducing sugars β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (DNS assay) in aqueous phase Acetone 20% 100 100 % ? Incubation: 6, Assay: ? Incubation: 30Β°C, Assay: 37Β°C 0.5% (w/v) Glucomannan Reducing sugars β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*