Lipase (gene Pflip1) from Pseudomonas fluorescens Pf0–1

Enzyme Description

Species
Pseudomonas fluorescens Pf0–1 β†—
Extremophile
No
EC Number
3.1.1.3 β†—

Sequence

Length: 296 amino acids
MSQDSATRYPLVLVPGMLGFIRLVLYPYWYGIIKALRRGGATVIAVQVSPLNSTEVRGEQLLTRIDEILRETGAAKVNLFGHSQGSLTARYAAAKRPDLVASVTSVAGPNHGSELADYLAKYYPADSAKGRILEALLRSVGWLMALLETGYHGPKLPVDIHASHHSLTTEGVALFNQLYPQGLPQTWGGHGPEEVNGVRYYSWSGTLQPGKTDRGGNLFDGTNRSCRLFAKTFVREPGQCDGMVGRYSSHLGTVIGDDYPMDHFDIVNQSLGLVGKGADPVRLFVEHAARLKAAGV
Wu Liu et al. (2017) β€” Heterologous expression and characterization of a new lipase from Pseudomonas fluorescens Pf0–1 and used for biodiesel production
Scientific Reports  Β· doi:10.1038/s41598-017-16036-7 β†—  Β· Stability - Incubation
7 measurements ▼
Database ID
UniProt: Q3KIU1 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (7 measurements)

7 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 30% 100.0 112.3 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 70Β°C 1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about control
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 30% 100.0 118.1 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 70Β°C 1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about control
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase tert-Butanol 30% 100.0 130.2 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 70Β°C 1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about control
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Glycerol 30% 100.0 119.4 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 70Β°C 1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about control
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 30% 100.0 130.3 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 70Β°C 1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about control
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Chloroform 30% 100.0 78.1 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 70Β°C 1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about control
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Hexane 30% 100.0 134.4 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 70Β°C 1 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about control

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*