Lipase (gene PleoLip241) from Pleurotus ostreatus

Enzyme Description

Species
Pleurotus ostreatus β†—
Extremophile
No
EC Number
3.1.1.3 β†—

Sequence

Length: 471 amino acids
MSEDCLRINVLRPAGIPTGVVLPVMAWVYGGGFDFGDSSIYNASAIVAQSVIRGTPVVFVSLNYRLGPLGFPQGVEAQKRGALNLGLKDQLAALEWVQANIGLFGGDKSKVTIFGQSAGSISLSIHFLNSNIKRLARAAIFESGFPATSLNFPASHREQGWANFVKDVPQCASTAGSKDTFSCLRSDSIDEATLLKAASLADDQSGELFAWDPTIDGPGGILPDIPSKLLARGQFARLPFIAGTVLDEATTFTPKFITTEDQIRQSIIANFTPSPFGPAVLAKTAETILQLYPDVPALGSPFGTGNETFGLSSQYKRAAAIFGDVSFQSQRRFWIQTLSKAGLKTFGYLFTDPQSSDPVNGVSHASEIPYVYGAPGIFGGTVTPQALALSRIMVDYWVSFATSLDPNDGKGLPRPLWTQYTPSNQAIMLLNSTGTAMIPDDYRKKQIDFINSNPAVWHHRRSFSTHHHHHH
Alessandra Piscitelli et al. (2017) β€” New lipases by mining of Pleurotus ostreatus genome
PLOS ONE  Β· doi:10.1371/journal.pone.0185377 β†—  Β· Stability - Incubation
14 measurements ▼
Database ID
UniProt: A0A8H7DWU5 β†—
Sequence Annotation
Explicit - Provided (first 90 residue from UniProt sequence removed from mature protein, 6 terminal residues added as His-tag)
Protein Source
Recombinant, host yeast Pichia pastoris

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 10% 100 70 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Glycerol 10% 100 81 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 10% 100 45 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 10% 100 70 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methyl Acetate 10% 100 65 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase tert-Butanol 10% 100 80 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethyl Acetate 10% 100 63 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 20% 100 70 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Glycerol 20% 100 68 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 20% 100 40 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 20% 100 75 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methyl Acetate 20% 100 50 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase tert-Butanol 20% 100 65 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethyl Acetate 20% 100 72 % Incubation: ?, Assay: 50 mM Tris-HCl buffer, 2% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°c 0.2 mM p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*