N-terminal truncated aminopeptidase (gene LapB) from Legionella pneumophila
Enzyme Description
Sequence
PINHEAQVHSLFEQIDPAKIWQTNQHLTSYINRSAKSRTGVEAAQWFKQQFDTLAQDYGRKDVESYFVKTGNKFIQPSVVTVIGKDKPGEAIVIGAHIDTLDGNMPGADDDSSGISVELEMARVVFSSNFELNRPIYFIAYAAEERGLIGSGYVVQDFLQKKIPVKAVMQLDQAGYRANAKDQTIWLLKDYVDKGLTEFTAELLTRYVKTPVGYTKCGYACSDHVNWTNEGFKTTYPSATTLDDDNPYVHTSNDTLDILNLEHMVNFTKLGLAFIVELGLN
Nannan Zhang et al. (2017)
β Crystal Structure and Biochemical Characterization of an Aminopeptidase LapB from Legionella pneumophila
Journal of Agricultural and Food Chemistry
Β· doi:10.1021/acs.jafc.7b02849 β
Β· Activity - Classical
▼
Database ID
UniProt: Q5ZZH8 β
Sequence Annotation
Explicit - Provided (116 first residues from the UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta
Experimental Data (10 measurements)
10 measurements
| Mutation | Property | Assay | Solvent | Solvent Volume | Aqueous Reference | WT Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 20% | 100.0 | β | 76.1 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 60% | 100.0 | β | 44.8 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | 1-Propanol | 20% | 100.0 | β | 83.2 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | 1-Propanol | 60% | 100.0 | β | 40.1 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 20% | 100.0 | β | 159.3 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 60% | 100.0 | β | 67.9 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 20% | 100.0 | β | 92.1 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 60% | 100.0 | β | 71.4 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 20% | 100.0 | β | 74.4 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| DEL1-92 | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 60% | 100.0 | β | 22.4 | % | 50 mM Tris-HCl buffer | 8 | 37Β°C | 2 mM L-Lysine p-nitroanilide | L-Lysine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
Mutations in this dataset (1)
DEL1-92
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.