Ξ²-lactamase (gene habla) from Chromohalobacter sp. 560
Enzyme Description
Sequence
MKGWLLGVSLTLLGGGSVALAQDDASDRQTREVLDPIVASLMEAQQIPGMAIALVRPEGTTISHYGAADRETGTPVDDDTLFEIGSLSKTLTATLASLAEVEGKLDFDAPVSRYLPELEGSAFDDISGLNLGTHTGGGLPLFVPDEVTDRASLMAWYREWQPTEPIGESRTYSNLGIGLLGLETAASLDGEFVPTMRAKVLAPLGMQDTWYDVPEARMADYAMGEDKDGQPTRVSPGVLDDEAYGIKTTAADLAKLVRANLHLADVDAELQQAIDATRQGHYRVGDMTQALIWEQYSLPVAPETLRAGNGYDMILEPNAAEALEPPQSPRDDVWVNKTGSTNGFGGYIVMLPGKHTGLVMLANKNYPNDARVEAAYRILSGLGAIDVP
Hiroko Tokunaga et al. (2017)
β Reversible Activation of Halophilic Ξ²-lactamase from Methanol-Induced Inactive Form: Contrast to Irreversible Inactivation of Non-Halophilic Counterpart
The Protein Journal
Β· doi:10.1007/s10930-017-9715-0 β
Β· Activity - Classical
▼
Database ID
UniProt: Q76LX5 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (4 measurements)
4 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (reaction product absorbance measurement, 486 nm) in the presence of organic solvent | Methanol | 10% | 100 | 118 | % | 50 mM Tris-HCl buffer | 8 | Room temperature | 0.1 mM Nitrocefin | 5βnitroβ3βoxoβ3Hβphenoxazinβ7βylacetamidoβmethylβthiazolidineβ2βcarboxylate (ring-opened Ξ²-lactam form) | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (reaction product absorbance measurement, 486 nm) in the presence of organic solvent | Methanol | 20% | 100 | 126 | % | 50 mM Tris-HCl buffer | 8 | Room temperature | 0.1 mM Nitrocefin | 5βnitroβ3βoxoβ3Hβphenoxazinβ7βylacetamidoβmethylβthiazolidineβ2βcarboxylate (ring-opened Ξ²-lactam form) | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (reaction product absorbance measurement, 486 nm) in the presence of organic solvent | Methanol | 40% | 100 | 48 | % | 50 mM Tris-HCl buffer | 8 | Room temperature | 0.1 mM Nitrocefin | 5βnitroβ3βoxoβ3Hβphenoxazinβ7βylacetamidoβmethylβthiazolidineβ2βcarboxylate (ring-opened Ξ²-lactam form) | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (reaction product absorbance measurement, 486 nm) in the presence of organic solvent | Methanol | 60% | 100 | 2 | % | 50 mM Tris-HCl buffer | 8 | Room temperature | 0.1 mM Nitrocefin | 5βnitroβ3βoxoβ3Hβphenoxazinβ7βylacetamidoβmethylβthiazolidineβ2βcarboxylate (ring-opened Ξ²-lactam form) | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.