B3-ta amine transaminase from a hot spring metagenomic library
Enzyme Description
Species
Na (hot spring metagenomic library)
Extremophile
Yes
thermophilic organism (from a hot spring)
EC Number
Sequence
MQVETWNAAELVRKDIRHHLHPVTNLHQLRREGPLVLVRGEGSWVWDAEGHRYLDGFAGLWNVNIGHGRVELAEAARAQMERIAFAPTFFGIASPPTIELAARLAELFPDPLNVFQFTSGGAESNETAIKIARYYWWLKGQPERIKILSRRMAYHGIAMGALSATGVPSYWEGFGPRPPGFIHLTAPYKYRFGEGLSDEEFVARLVQELEETIQREGPETIAAFIGEPVQGAGGVVVPPEGYWPAIAAVLRRYGILLILDEVITGFGRTGTLFGMQQYGIVPDIVSFAKGITSGYVPLGGVGVSDEIADTLASADRVFMHGFTYSGHPVACAVALRNLEILLAERLWENAAEAGSYLLNELRRLEERPYVGEVRGKGLMLLVEVVRDKATKEKFPPEFKLGPKLEAATRRRGVIVRCTPDGIIMAPPLTITREECDVLIEAVAGALSDVLDREYA
Erica Elisa Ferrandi et al. (2017)
β Novel thermostable amine transferases from hot spring metagenomes
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-017-8228-2 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI0009C35B14 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Methanol | 5% | 100 | 92 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Methanol | 10% | 100 | 75 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Methanol | 20% | 100 | 70 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Ethanol | 5% | 100 | 100 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Ethanol | 10% | 100 | 75 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Ethanol | 20% | 100 | 21 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 5% | 100 | 100 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10% | 100 | 70 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 20% | 100 | 62 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Acetonitrile | 5% | 100 | 83 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Acetonitrile | 10% | 100 | 50 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase | Acetonitrile | 20% | 100 | 42 | % | Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) | Incubation: 8, Assay: 8 | Incubation: 25Β°C, Assay: 20Β°C | 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate | Acetophenone , L-Alanine | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.