Ξ²-1,4-mannanase (gene AoMan134A) from Aspergillus oryzae RIB40
Enzyme Description
Species
Extremophile
No
but "thermostable" enzyme
EC Number
Sequence
MKFFIPCIAAIFATGVLAAPTPDASLNVPLDKRDDRGQYTVSGLGSRKKAIIDAGGNSLDLAIAMLEIETMNTAHYPYGDGKTYDAANFGLFKQNWGLLRKSSDVYADVASRWDCQNYYGYDKWFAGHRNGASGLANPYTEDINTYKSAVHWIQQQIDSNEKYKYDDTRFWVNVRAI
Kiyota Sakai et al. (2017)
β Biochemical characterization of thermostable Ξ²-1,4-mannanase belonging to the glycoside hydrolase family 134 from Aspergillus oryzae
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-017-8107-x β
Β· Stability - Incubation
▼
Database ID
UniProt: Q2U2I2 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host yeast Pichia pastoris KM71H
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Methanol | 5% | 100.0 | 75.7 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Methanol | 10% | 100.0 | 70.4 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Methanol | 20% | 100.0 | 68.1 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Ethanol | 5% | 100.0 | 80.2 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Ethanol | 10% | 100.0 | 65.1 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Ethanol | 20% | 100.0 | 69.3 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Isopropanol | 5% | 100.0 | 88.2 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Isopropanol | 10% | 100.0 | 73.8 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Isopropanol | 20% | 100.0 | 58.7 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Acetone | 5% | 100.0 | 105.2 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Acetone | 10% | 100.0 | 100.7 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (DNS assay) | Acetone | 20% | 100.0 | 96.9 | % | Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 60Β°C, Assay: 30Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.