Carboxylesterase (gene Est06) from a forest soil metagenomic library

Enzyme Description

Species
Na (forest soil metagenomic library)
Extremophile
No
EC Number
3.1.1.79 β†—

Sequence

Length: 296 amino acids
MSQQQLQQIIQMLKAQPIAGHPTVQETRANFEQMAALFPVAADVKCEPVNAGGIKAEWVTAPGADAGRAVLYLHGGGYVIGSINTHRDLGARISRAAKARVLLIDYRLAPEHPFPAAVEDSVTAYRWMLAQGFKASRIAIAGDSAGGGLTVAALVAIRDAKLASPGAGVCLSPWTDLEGLGDSMKSKASVDPMVNKEALAEMAAHYLAGQNPRSPLAAPLYADLAGLPPLLIHVGTAETLLDDSTRLAERARKAGVKVTLEPWENMIHVFQVFAPMLDEGQEAIEKIGEFVRANAA
AmΓ©lie Dukunde et al. (2017) β€” A novel, versatile family IV carboxylesterase exhibits high stability and activity in a broad pH spectrum
Biotechnology Letters  Β· doi:10.1007/s10529-016-2282-1 β†—  Β· Stability - Incubation
12 measurements ▼
Database ID
UniProt: G3CRD1 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (12 measurements)

12 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 25% 100.0 129.7 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 25% 100.0 71.2 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 25% 100.0 14.1 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 25% 100.0 7.8 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 25% 100.0 36.6 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Propanol 25% 100.0 0.0 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100.0 72.3 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 50% 100.0 0.0 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 50% 100.0 0.0 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 50% 100.0 0.0 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 50% 100.0 0.2 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Propanol 50% 100.0 0.1 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 25Β°C 1 mM p-Nitrophenyl valerate p-Nitrophenol , Pentanoic Acid β€” Yes, "shaking incubator" Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*