Chymotrypsin from Helicoverpa armigera
Enzyme Description
Sequence
MKFVALTLLALAAVASARNVHLEDSIDLEDITAWGYLTKFGIPEAEKIRSAEEASSASRIVGGSLSSLGQIPYQAGLVIDLSGGQAVCGGSLISASRVLTAAHCWFDGQNQAWRFTVVLGSTTLFSGGTRIATSNVVMHGSWTPSLIRNDVAVIRLGTNVGTSNTIAIIALPSGSQINENFAGETALASGFGLTSDSGSISSNQALSHVNLPVITNAVCRSSFPLLIQDSNICTSGANGRSTCRGDSGGPLAVTRNSRPLLIGITSFGSARGCQVGSPAAFARVTSYISWINGQL
Shaik Mohammad Akbar et al. (2016)
β Alkaline serine proteases from Helicoverpa armigera : potential candidates for industrial applications
Archives of Insect Biochemistry and Physiology
Β· doi:10.1002/arch.21367 β
Β· Activity - Classical
▼
Database ID
UniProt: D7RZZ6 β
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, insect Helicoverpa armigera
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Methanol | 5% | 100.0 | 114.39 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Ethanol | 5% | 100.0 | 105.77 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | 1-Propanol | 5% | 100.0 | 97.33 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | 1-Butanol | 5% | 100.0 | 105.3 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Acetone | 5% | 100.0 | 112.55 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | n-Hexane | 5% | 100.0 | 111.62 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5% | 100.0 | 118.98 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 5% | 100.0 | 110.17 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Benzene | 5% | 100.0 | 112.59 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Toluene | 5% | 100.0 | 108.69 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Diethyl Ether | 5% | 100.0 | 90.0 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Chloroform | 5% | 100.0 | 106.06 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 0.1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-Nitroaniline , Suc-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.