Trypsin from Helicoverpa armigera
Enzyme Description
Sequence
MRILAVLALCVAAVAAVQRTPGSRIVGGSLTTIDRYPTIAALLYSSNLVQYWQDCGGTILNNRAILTAAHCTVGFAANRFRIRVGSTWANSGGAVHNVASNIIHPQFNRWNLNNDVAVLRVSNTFSFNNNVRAASIAGANYNVGDNQAVWAAGWGDTFYGSEQGSEQLRHVQLSIVNQNTCRNNYATRGVLVNENMICAGWPSGGRDQCQGDSGGPLYHNGIVVGVCSFGINCGDAFFPGVSARVSRYTSWISSNA
Shaik Mohammad Akbar et al. (2016)
β Alkaline serine proteases from Helicoverpa armigera : potential candidates for industrial applications
Archives of Insect Biochemistry and Physiology
Β· doi:10.1002/arch.21367 β
Β· Activity - Classical
▼
Database ID
UniProt: O18441 β
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, insect Helicoverpa armigera
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Methanol | 5% | 100.0 | 114.5 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Ethanol | 5% | 100.0 | 118.8 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | 1-Propanol | 5% | 100.0 | 125.55 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | 1-Butanol | 5% | 100.0 | 127.0 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Acetone | 5% | 100.0 | 112.63 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | n-Hexane | 5% | 100.0 | 115.17 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5% | 100.0 | 93.41 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 5% | 100.0 | 118.87 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Benzene | 5% | 100.0 | 125.56 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Toluene | 5% | 100.0 | 86.75 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Diethyl Ether | 5% | 100.0 | 117.68 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Chloroform | 5% | 100.0 | 116.72 | % | 100 mM glycineβNaOH buffer | 10 | 37Β°C | 1 mM Benzoyl-DL-arginine p-nitroanilide | NΞ±-benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.