Lipase (gene ReLipB) from Rhizomucor endophyticus strain 3.4684

Enzyme Description

Species
Rhizomucor endophyticus strain 3.4684 β†—
Extremophile
No but "cold-active" enzyme
EC Number
3.1.1.3 β†—

Sequence

Length: 398 amino acids
MVSFTSITQGIVLVSIVLLGSSSAAPAPGGKAGSSSTPTNDNVTDVAPHANATNTASFKLPPLISSRTRPASHPEFAGNLQAEAESIERNKQWFIAHGGNFNNITKRDDSNTVGGMTLDLPENAPPIFSTEKKGSVINASSAQIKDFKFHAALSASGYCRGVVPLGSWSCEQCLKYIPDGKLIVTFTTLLSDSNGYVLRSDAQKTIHLVFRGTNSIRNAVTDLTFGLTNYPPVKGAKVHTGFLASYNEVVGKFFPSIQAQLTAYPNYKVVVSGHSFGGAQALLAGMDLYQREKRLSSKNLSIYTVGCPRVGNPAFAYYVDSTGIPFSRSVNKRDVVPHLPPQSFGFLHPGVEAWTKSSNDVQICNSNLETNDCSNTIVPFTSIIDHLTYYDINQGLCL
Xiaojie Duan et al. (2016) β€” High-level expression and biochemical characterization of a novel cold-active lipase from Rhizomucor endophyticus
Biotechnology Letters  Β· doi:10.1007/s10529-016-2200-6 β†—  Β· Stability - Incubation
10 measurements ▼
Database ID
UniProt: A0A1B2LUC2 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host yeast Pichia pastoris GS115

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 30% 100.0 14.4 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 30% 100.0 4.2 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Butanol 30% 100.0 3.8 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isopropanol 30% 100.0 3.1 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 30% 100.0 50.7 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Cyclohexane 30% 100.0 122.0 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Hexane 30% 100.0 144.0 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Heptane 30% 100.0 115.0 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isooctane 30% 100.0 172.0 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Petroleum Ether 30% 100.0 156.0 % Incubation: 50 mM Tris-HCl, Assay: 40 mM Tris-HCl Incubation: 7.5, Assay: 7.5 Incubation: 30Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*