Serine protease from Trichoderma koningii

Enzyme Description

Species
Trichoderma koningii β†—
Extremophile
No
EC Number
3.4.- β†—

Sequence

Length: 391 amino acids
MRLSVLLSVLPLVLVAPATEKRAEPAPLLVPTTKHGLVADKYIVKFKDGSSLQAVDEAISGLVSNADHVYQHVFRGFAATLDKKTLETLRNHPEVDYIEQDAVVKINSYVSQSGAPWGLGRISHKARGSTTYVYDDSAGAGTCSYVIDTGVDAAHPDFEGRATLLRSFVSGQNTDGNGHGTHVSGTIGSRTYGVAKKTQIYGIKVLDNSGSGSFSTVIAGMDYVASDSQTRNCPNGSVANMSLGGGYTASVNQAAARLIQAGVFLAVAAGNDGVDARNTSPASEPSVCTVGASTSSDARASFSNYGSVVDIFAPGQDILSTWPNRQTNAISGTSMATPHIVGLGAYLAGLEGFSDPQALCARIQALAGRNLLSGIPSGTINAIAFNGNPSG
Min Shu et al. (2016) β€” High-level expression and characterization of a novel serine protease in Pichia pastoris by multi-copy integration
Enzyme and Microbial Technology  Β· doi:10.1016/j.enzmictec.2016.06.007 β†—  Β· Stability - Incubation
18 measurements ▼
Database ID
UniProt: A2TM20 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host yeast Pichia pastoris GS115

Experimental Data (18 measurements)

18 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Isopropanol 10% 100 100 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Glycerol 10% 100 106 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Glycerol 5% 100 102 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Acetonitrile 10% 100 96 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Acetonitrile 5% 100 100 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Acetone 10% 100 3 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Acetone 5% 100 46 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase 1-Butanol 10% 100 47 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase 1-Butanol 5% 100 72 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Methanol 5% 100 103 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Isopropanol 5% 100 101 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase 1-Propanol 10% 100 87 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase 1-Propanol 5% 100 96 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Ethylene Glycol 10% 100 106 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Ethylene Glycol 5% 100 103 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Ethanol 10% 100 109 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Ethanol 5% 100 103 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase Methanol 10% 100 104 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 55Β°C 0.5% (w/v) Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*