Lipase (gene LipBST) from Bacillus stratosphericus L1
Enzyme Description
Sequence
MKVICFKKKSLQILVALALVIGSMAFIQPKEVKAAAHNPVVMVHGMGGASYNFASIKRYLVSQGWDQNQLFAIDFIDKTGNNLNNGPRLSRFVKDVLAKTGAKKVDIVAHSMGGANTLYYIKNLDGGDKIENVVTLGGANGLVSLRALPGTDPNQKILYTSVYSSADLIVVNSLSRLIGARNVLIHGVGHIGLLTSSQVKGYVKEGLNGGGQNTN
Alisa Gricajeva et al. (2016)
β Lipase of Bacillus stratosphericus L1: Cloning, expression and characterization
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2016.07.015 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A0D5CCJ2 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (6 measurements)
6 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Isopropanol | 50% | 100 | 10 | % | Incubation: 50 mM Briton-Robinson buffer, Assay: 50 mM Briton-Robinson buffer, 0.1% gum arabic and 0.2% sodium deoxycholate | Incubation: 9, Assay: 9 | Incubation: 35Β°C, Assay: 35Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethanol | 50% | 100 | 8 | % | Incubation: 50 mM Briton-Robinson buffer, Assay: 50 mM Briton-Robinson buffer, 0.1% gum arabic and 0.2% sodium deoxycholate | Incubation: 9, Assay: 9 | Incubation: 35Β°C, Assay: 35Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 50% | 100 | 59 | % | Incubation: 50 mM Briton-Robinson buffer, Assay: 50 mM Briton-Robinson buffer, 0.1% gum arabic and 0.2% sodium deoxycholate | Incubation: 9, Assay: 9 | Incubation: 35Β°C, Assay: 35Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 50% | 100 | 131 | % | Incubation: 50 mM Briton-Robinson buffer, Assay: 50 mM Briton-Robinson buffer, 0.1% gum arabic and 0.2% sodium deoxycholate | Incubation: 9, Assay: 9 | Incubation: 35Β°C, Assay: 35Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexane | 50% | 100 | 116 | % | Incubation: 50 mM Briton-Robinson buffer, Assay: 50 mM Briton-Robinson buffer, 0.1% gum arabic and 0.2% sodium deoxycholate | Incubation: 9, Assay: 9 | Incubation: 35Β°C, Assay: 35Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50% | 100 | 34 | % | Incubation: 50 mM Briton-Robinson buffer, Assay: 50 mM Briton-Robinson buffer, 0.1% gum arabic and 0.2% sodium deoxycholate | Incubation: 9, Assay: 9 | Incubation: 35Β°C, Assay: 35Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay measured in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.