Cathepsin B from Homo sapiens

Enzyme Description

Species

Extremophile

EC Number

3.4.22.1 ↗

Sequence

Length: 339 amino acids

MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

Boris Turk et al. (1994) — Human Cathepsin B Is a Metastable Enzyme Stabilized by Specific Ionic Interactions Associated with the Active Site

Biochemistry · doi:10.1021/bi00253a019 ↗ · Stability - Inactivation Rate Constant

5 measurements ▼

Database ID

UniProt: P07858 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Purified, eukaryote Homo sapiens

Experimental Data (5 measurements)

5 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	0.1%	8.5	8.53	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin) , Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)
Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	2.5%	8.5	11.07	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin) , Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)
Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	8.5	13.68	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin) , Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)
Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	7.5%	8.5	14.61	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin) , Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)
Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	8.5	15.68	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin) , Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)

Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	0.1%	8.5	8.53	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin), Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)
Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	2.5%	8.5	11.07	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin), Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)
Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	8.5	13.68	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin), Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)
Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	7.5%	8.5	14.61	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin), Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)
Stability - Inactivation Rate Constant	Enzyme inactivation rate constant ((in 1/ms), measured by fluorescence spectrophotometry (7-amino-4-methylcoumarin fluorescence measurement, excitation at 370 nm, absorbance measurement at 470 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	8.5	15.68	1/ms	0.1 M phosphate buffer	8	37°C	0.02-1 mM Z-Arg-Arg-AMC	AMC (7-amino-4-methylcoumarin), Z-Arg-Arg	—	—	Classical aqueous control (in 1/ms)

Visualization : Stability — Inactivation Rate Constant

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*