Aminotransferase from Thermoproteus uzoniensis

Enzyme Description

Species

Thermoproteus uzoniensis ↗

Extremophile

Yes "hyperthermophilic" organism

EC Number

2.6.1.42 ↗

Sequence

Length: 295 amino acids

MKVWLDGRLVDEEEAKVTVLSPSLNYGFGVFEGIRAYWNGENLYVFRLRDHMERLLRSAKIIGLDVPYTAEELSKAVVETVRANGFKEDLYIRPVAYISKPQISLDVRGLQASVAIAAIPFGKYLKVEGVRAAVVSWRRVHTSMMPVMAKATGIYLNSIMAAVEARARGYDEAIMLNAEGKVVEGSGENIFIVRRGVLMTPPLEDGILEGITRETVISIAGDLGIPLLEKSITREELYAADEAFFVGTAAEITPIIEIDGRVLQRGPITQKIAETYRRIVLGKEEKYLPWLTPVY

Konstantin M. Boyko et al. (2016) — First structure of archaeal branched-chain amino acid aminotransferase from Thermoproteus uzoniensis specific for l-amino acids and R-amines

Extremophiles · doi:10.1007/s00792-016-0816-z ↗ · Activity - Classical

4 measurements ▼

Database ID

UniProt: F2L0W0 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli DLT1270

Experimental Data (4 measurements)

4 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (alanine dehydrogenase assay, L-alanine dehydrogenation by an alanine dehydrgenase from Bacillus cereus, and NADH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100	62	%	50 mM Tris–HCl buffer, 100 mM NaCl	9	65°C	20 mM L-Leucine, 20 mM Pyruvate	L-Alanine , α-Ketoisocaproate	60 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (alanine dehydrogenase assay, L-alanine dehydrogenation by an alanine dehydrgenase from Bacillus cereus, and NADH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethylformamide (DMF)	15%	100	17	%	50 mM Tris–HCl buffer, 100 mM NaCl	9	65°C	20 mM L-Leucine, 20 mM Pyruvate	L-Alanine , α-Ketoisocaproate	60 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (alanine dehydrogenase assay, L-alanine dehydrogenation by an alanine dehydrgenase from Bacillus cereus, and NADH absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100	31	%	50 mM Tris–HCl buffer, 100 mM NaCl	9	65°C	20 mM L-Leucine, 20 mM Pyruvate	L-Alanine , α-Ketoisocaproate	60 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (alanine dehydrogenase assay, L-alanine dehydrogenation by an alanine dehydrgenase from Bacillus cereus, and NADH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	15%	100	6	%	50 mM Tris–HCl buffer, 100 mM NaCl	9	65°C	20 mM L-Leucine, 20 mM Pyruvate	L-Alanine , α-Ketoisocaproate	60 μM PLP	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (alanine dehydrogenase assay, L-alanine dehydrogenation by an alanine dehydrgenase from Bacillus cereus, and NADH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100	62	%	50 mM Tris–HCl buffer, 100 mM NaCl	9	65°C	20 mM L-Leucine, 20 mM Pyruvate	L-Alanine, α-Ketoisocaproate	60 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (alanine dehydrogenase assay, L-alanine dehydrogenation by an alanine dehydrgenase from Bacillus cereus, and NADH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethylformamide (DMF)	15%	100	17	%	50 mM Tris–HCl buffer, 100 mM NaCl	9	65°C	20 mM L-Leucine, 20 mM Pyruvate	L-Alanine, α-Ketoisocaproate	60 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (alanine dehydrogenase assay, L-alanine dehydrogenation by an alanine dehydrgenase from Bacillus cereus, and NADH absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100	31	%	50 mM Tris–HCl buffer, 100 mM NaCl	9	65°C	20 mM L-Leucine, 20 mM Pyruvate	L-Alanine, α-Ketoisocaproate	60 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (alanine dehydrogenase assay, L-alanine dehydrogenation by an alanine dehydrgenase from Bacillus cereus, and NADH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	15%	100	6	%	50 mM Tris–HCl buffer, 100 mM NaCl	9	65°C	20 mM L-Leucine, 20 mM Pyruvate	L-Alanine, α-Ketoisocaproate	60 μM PLP	—	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*