Carboxylesterase (gene CaesCCR11) from Geobacillus thermoleovoras CR11

Enzyme Description

Species
Geobacillus thermoleovoras CCR11 β†—
Extremophile
Yes "thermophilic" organism
EC Number
3.1.1.1 β†—

Sequence

Length: 250 amino acids
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSTGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLTRLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVCLRNSYHVATLDYDQPMIIERSLEFFAKHAG
Graciela Espinosa-Luna et al. (2015) β€” Gene Cloning and Characterization of the Geobacillus thermoleovorans CCR11 Carboxylesterase CaesCCR11, a New Member of Family XV
Molecular Biotechnology  Β· doi:10.1007/s12033-015-9901-2 β†—  Β· Stability - Incubation
9 measurements ▼
Database ID
UniProt: W8QMJ2 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (9 measurements)

9 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1,4-Dioxane 100% 100.0 13.2 % Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol Incubation: /, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme
Stability - Incubation Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 100% 100.0 12.7 % Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol Incubation: /, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme
Stability - Incubation Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethyl Acetate 100% 100.0 24.8 % Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol Incubation: /, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme
Stability - Incubation Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 100% 100.0 27.5 % Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol Incubation: /, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme
Stability - Incubation Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 100% 100.0 21.8 % Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol Incubation: /, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme
Stability - Incubation Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Propanol 100% 100.0 13.1 % Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol Incubation: /, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme
Stability - Incubation Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Butanol 100% 100.0 22.9 % Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol Incubation: /, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme
Stability - Incubation Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Hexane 100% 100.0 59.2 % Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol Incubation: /, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme
Stability - Incubation Activity after incubation (lyophilized enzyme, 1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Heptane 100% 100.0 74.6 % Incubation: /, Assay: 40 mM phosphate buffer, 10% Ethanol Incubation: /, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Lyophilized enzyme

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*