ω-transaminase from Geobacillus thermodenitrificans DSM 465

Enzyme Description

Species

Geobacillus thermodenitrificans DSM465 ↗

Extremophile

Yes "thermophilic" organism

EC Number

2.6.1.77 ↗

Sequence

Length: 450 amino acids

MKTEQSHQLWLDKDDRYIWHSMKPYNPNATVVVTEAKGCWVTDVAGNKYLDAMAGLWCVNVGYGREELAEAAYEQLKTLPYFPLTQSHLPAIQLGEKLNELLGDEYVIFFSNSGSEANETAFKIARQYHQQRGEPHRYKIISRYRAYHGNSMGALAATGQAQRKYKYEPLAPGFIHVPPPDRYRDPDAADDPRQLRAVKAVDDVMTWELSETIAAMIMEPIITGGGVLMPPDGYMKAVKEVCEKHGALLIVDEVICGFGRTGKPFGFMHEGIKPDIITMAKGITSAYLPLAATAVRKEIYEAFKGTDEYDYFRHVNTFGGHPASCALALKNIEIMETEHLFDRSREAGEWLLSALKTKLADHPYVGDVRGRGLLVGIELVADQTTKEPLDVSLVNQVISRCKEHGVIIGKNGATVAGYNNVLTLSPPLCISDDELSFLVRVLTEALAQIK

Yujie Chen et al. (2015) — Identification of novel thermostable taurine–pyruvate transaminase from Geobacillus thermodenitrificans for chiral amine synthesis

Applied Microbiology and Biotechnology · doi:10.1007/s00253-015-7129-5 ↗ · Activity - Classical

7 measurements ▼

Database ID

UniProt: A0A0S2VC96 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (7 measurements)

7 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Methanol	5%	100	83	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone , L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Methanol	10%	100	46	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone , L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Methanol	20%	100	15	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone , L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	107	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone , L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	134	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone , L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	81	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone , L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100	23	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone , L-Alanine	20 μM PLP	—	Classical aqueous control (in %)

Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Methanol	5%	100	83	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone, L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Methanol	10%	100	46	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone, L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Methanol	20%	100	15	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone, L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	107	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone, L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	134	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone, L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	81	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone, L-Alanine	20 μM PLP	—	Classical aqueous control (in %)
Activity - Classical	Activity (acetophenone product formation after 10 minutes incubation at 37°C) measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100	23	%	100 mM Tris-HCl buffer	9	37°C	10 mM (S)-α-methylbenzylamine, 10 mM Pyruvate	Acetophenone, L-Alanine	20 μM PLP	—	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*