Pepsin A from Sus scrofa (pig)

Enzyme Description

Species

Extremophile

EC Number

3.4.23.1 ↗, 3.4.23.1 ↗ (synthesis direction)

Sequence

Length: 326 amino acids

IGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA

Marcelo Porto Bemquerer et al. (1994) — Pepsin-catalyzed peptide synthesis in organic media: studies with free and immobilized enzyme

International Journal of Peptide and Protein Research · doi:10.1111/j.1399-3011.1994.tb00181.x ↗ · Activity + Stability - Product Formation

10 measurements ▼

Database ID

UniProt: P00791 ↗

Sequence Annotation

Inferred - from protein name (first 59 UniProt residues cleaved)

Protein Source

Commercially purchased

Experimental Data (10 measurements)

10 measurements

Property	Assay	Solvent	Solvent Volume	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Butyl Acetate	95%	0	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Diisopropyl Ether	95%	25	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Benzene	95%	21	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Toluene	95%	45	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Carbon tetrachloride	95%	25	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Cyclohexane	95%	58	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	n-Hexane	95%	70	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	n-Heptane	95%	69	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	n-Octane	95%	72	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Isooctane	95%	70	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)

Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Butyl Acetate	95%	0	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Diisopropyl Ether	95%	25	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Benzene	95%	21	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Toluene	95%	45	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Carbon tetrachloride	95%	25	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Cyclohexane	95%	58	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	n-Hexane	95%	70	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	n-Heptane	95%	69	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	n-Octane	95%	72	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)
Activity + Stability - Product Formation	Reaction yield after incubation (72 hours at 38°C ) in the presence of organic solvent, measured by HPLC	Isooctane	95%	70	%	0.2 M Citrate buffer	6	38°C	0.08 mM Benzyloxycarbonyl-L-phenylalanine, 0.16 mM L-Phenylalanine methyl ester.HCl	Z-Phe-L-Phenylalanine methyl ester	—	250 rpm	Classical aqueous control (in %) \| Protease in synthesis mode/ deducted yield for control (protease then in hydrolysis mode)

Visualization : Activity + Stability — Product Formation

Marcelo Porto Bemquerer et al. (1994)

One bar per measurement. Colour = solvent, shade = solvent volume.

T. Cardoso et al. (2009) — Acetonitrile-induced unfolding of porcine pepsin A

International Journal of Biological Macromolecules · doi:10.1016/j.ijbiomac.2009.05.006 ↗ · Activity - Classical Stability - Tm

18 measurements ▼

Database ID

UniProt: P00791 ↗

Sequence Annotation

Inferred - from protein name (first 59 UniProt residues cleaved)

Protein Source

Commercially purchased

Experimental Data (18 measurements)

18 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	2.8M	100.0	24.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	17.1M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	15.2M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	13.3M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	11.4M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	9.5M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	7.5M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	5.6M	100.0	2.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	3.8M	100.0	12.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	1.9M	100.0	57.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	0.9M	100.0	82.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	0.75M	100.0	88.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	0.5M	100.0	93.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	0.3M	100.0	96.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe , Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Stability - Tm	Tm after incubation with organic co-solvent (1 hour at 25°C) measured by DSC in the presence of organic solvent	Acetonitrile	0.9M	72.3	67.4	°C	10 mM sodium acetate	3	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm after incubation with organic co-solvent (1 hour at 25°C) measured by DSC in the presence of organic solvent	Acetonitrile	4.8M	72.3	50.7	°C	10 mM sodium acetate	3	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm after incubation with organic co-solvent (1 hour at 25°C) measured by DSC in the presence of organic solvent	Acetonitrile	2.8M	72.3	55.6	°C	10 mM sodium acetate	3	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm after incubation with organic co-solvent (1 hour at 25°C) measured by DSC in the presence of organic solvent	Acetonitrile	1.9M	72.3	62.3	°C	10 mM sodium acetate	3	—	—	—	—	—	Classical aqueous control (in °C)

Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	2.8M	100.0	24.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	17.1M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	15.2M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	13.3M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	11.4M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	9.5M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	7.5M	100.0	0.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	5.6M	100.0	2.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	3.8M	100.0	12.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	1.9M	100.0	57.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	0.9M	100.0	82.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	0.75M	100.0	88.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	0.5M	100.0	93.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	0.3M	100.0	96.0	%	0.05 M sodium acetate, 0.2 M sodium chloride, 4% DMSO (Dimethyl Sulfoxide)	3	25°C	? mM H-Leu-Ser-p-nitro-Phe-Nle-Ala-Leu-OMe	H-Leu-Ser-p-nitro-Phe, Nle-Ala-Leu-OMe	—	—	Classical aqueous control (in %)
Stability - Tm	Tm after incubation with organic co-solvent (1 hour at 25°C) measured by DSC in the presence of organic solvent	Acetonitrile	0.9M	72.3	67.4	°C	10 mM sodium acetate	3	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm after incubation with organic co-solvent (1 hour at 25°C) measured by DSC in the presence of organic solvent	Acetonitrile	4.8M	72.3	50.7	°C	10 mM sodium acetate	3	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm after incubation with organic co-solvent (1 hour at 25°C) measured by DSC in the presence of organic solvent	Acetonitrile	2.8M	72.3	55.6	°C	10 mM sodium acetate	3	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm after incubation with organic co-solvent (1 hour at 25°C) measured by DSC in the presence of organic solvent	Acetonitrile	1.9M	72.3	62.3	°C	10 mM sodium acetate	3	—	—	—	—	—	Classical aqueous control (in °C)

Visualization : Activity — Classical

T. Cardoso et al. (2009)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — T_m

T. Cardoso et al. (2009)

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*

Pepsin A from Sus scrofa (pig)

Enzyme Description

Sequence

Experimental Data (10 measurements)

Visualization : Activity + Stability — Product Formation

Experimental Data (18 measurements)

Visualization : Activity — Classical

Visualization : Stability — Tm

Structure

Loading…

Visualization : Stability — T_m