Xylanase (gene xynA) from Bacillus licheniformis 9945A
Enzyme Description
Sequence
MFKFKKNFLVGVTAALMSISLFSATASAASPDYWQNWTDGGGTVNAVNGPGGNYSVNWSNTGNFVVGKGWTTGSPSRTINYNAGVWAPNGNGYLALYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGEKTTFTQYWSVRQTKRPTGSNAKITFSNHVRAWKSHGMNLGSIWSYQVLATEGYQSSGSSNVTVW
Asma Zafar et al. (2015)
β Cloning, Expression, and Purification of Xylanase Gene from Bacillus licheniformis for Use in Saccharification of Plant Biomass
Applied Biochemistry and Biotechnology
Β· doi:10.1007/s12010-015-1872-z β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI0003423E93 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (20 measurements)
20 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Isopropanol | 30% | 100 | 54 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 40% | 100 | 42 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 30% | 100 | 50 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 20% | 100 | 51 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 10% | 100 | 59 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Butanol | 40% | 100 | 59 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Butanol | 30% | 100 | 63 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Butanol | 20% | 100 | 68 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Butanol | 10% | 100 | 79 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Isopropanol | 40% | 100 | 48 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 10% | 100 | 68 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Isopropanol | 20% | 100 | 60 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Isopropanol | 10% | 100 | 62 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 40% | 100 | 60 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 30% | 100 | 59 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 20% | 100 | 61 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 10% | 100 | 72 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 40% | 100 | 53 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 30% | 100 | 59 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 20% | 100 | 62 | % | ? | ? | Incubation: Room temperature, Assay: ? | 1% Xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.