Lipase (UniParc : UPI0006BCF614) from a shallow hot vent sediment metagenomic library

Enzyme Description

Species

Na (shallow hot vent sediment metagenomic library)

Extremophile

Yes extremophilic organsim (from hydrothermal vent), "thermoresistant" enzyme

EC Number

3.1.1.1 ↗

Sequence

Length: 272 amino acids

MTITTSERTRPMWQEHIAGRKIGLETGPRPFDPHKPCLLMVHGSGGRGETFRPQLSGLAPYLNPAAIDLPGHGNTPGPGRDQVAHYADWLAEFIRRGPLRPALLGHSLGGAIVMQLALDHPDLAPALVLVGTGSRLRVLPAILDGLLSDFDATLDLVLKYAYAPGADPRWVQAGREIMSQPGPRVVHDDFAACDRYDITDRLGEITAPTLLIYGDQDQLTPPKYGRFLAERLPDARLEIVAGAGHMVNLERHAEVNRLIPPFISAFSPPASS

Antonio Placido: Tran Hai et al. (2015) — Diversity of hydrolases from hydrothermal vent sediments of the Levante Bay, Vulcano Island (Aeolian archipelago) identified by activity-based metagenomics and biochemical characterization of new esterases and an arabinopyranosidase

Applied Microbiology and Biotechnology · doi:10.1007/s00253-015-6873-x ↗ · Activity - Classical

6 measurements ▼

Database ID

UniParc: UPI0006BCF614 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (6 measurements)

6 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dibutyl Phosphate	5%	360	2600	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Acetonitrile	30%	360	1746	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Propylene Glycol	30%	360	1039	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Methanol	30%	360	769	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isopropanol	20%	360	732	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Ethanol	10%	360	500	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in U/mg)

Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dibutyl Phosphate	5%	360	2600	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Acetonitrile	30%	360	1746	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Propylene Glycol	30%	360	1039	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Methanol	30%	360	769	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isopropanol	20%	360	732	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in U/mg)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Ethanol	10%	360	500	U/mg	50 mM potassium phosphate buffer, 0.1% Triton X-100	7	30°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in U/mg)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*