Mannan endo-1,4-Ξ²-mannosidase (gene Bpman5) from Bacillus pumilus GBSW19
Enzyme Description
Species
Extremophile
No
but "thermostable" enzyme
EC Number
Sequence
MKKWTQRVFCFILVVAIWAGWFSLTIKAASYVQTSGTQFTLNNQPFYFAGTNNYYFHYKSKKMVDAVFGDMKAMNLKVIRIWGFHDGAPQENSVLQSSPGVHEESGFQKLDYAIYKAGQEGIKLVIPLVNNCDDFGGMNQYVKWFEAGTHDAFYTDPRIQKAYKNYVRYVLERTNTYTGVQYKDDPAIMTWELANEPRVQSDPTGNILVKWADEMSTWIKSLDHHHLVAVGDEGFFRIPGHEDWFYGGGEGVDWDRLTALSNIDYGTYHLYPDHWNKSAAWGVKWIEDHITRGKSIGKPVVLEEFGVQNQSARPDVYQSWLSAVERLGGAGSQFWILTSIQDDDSLYPDYDGFRIIKGSRESALISEHAKRMNEKNR
Haoyu Zang et al. (2015)
β A novel thermostable GH5_7 Ξ²-mannanase from Bacillus pumilus GBSW19 and its application in manno-oligosaccharides (MOS) production
Enzyme and Microbial Technology
Β· doi:10.1016/j.enzmictec.2015.06.007 β
Β· Stability - Incubation
▼
Database ID
UniProt: W0I643 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 10% | 100 | 87 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 10% | 100 | 97 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Isopropanol | 10% | 100 | 170 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 10% | 100 | 122 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 20% | 100 | 90 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 20% | 100 | 160 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Isopropanol | 20% | 100 | 155 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 20% | 100 | 140 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 30% | 100 | 92 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 30% | 100 | 92 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Isopropanol | 30% | 100 | 123 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (2 hours at 37Β°C), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 30% | 100 | 106 | % | Incubation: ?, Assay: 100 mM Tris-HCl | Incubation: ?, Assay: 7 | Incubation: 37Β°C, Assay: 60Β°C | 5 mg/ml Locust bean gum | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.