Lipase (gene LipR) from Pseudomonas sp. R0-14

Enzyme Description

Species
Pseudomonas sp. R0-14 β†—
Extremophile
No but isolated from "Arctic soil" so likely psychrotolerant organism
EC Number
3.1.1.3 β†—

Sequence

Length: 562 amino acids
MGLFDYKNADGKALYSDAIALTLYAYAPTGQPLPATGWVPIGATQLGYQGKVGAQGTFYGEKDGFTSAEAEVLGKYDAVGKLIGIGIAFRGTGGLGYSDTFGDMKNNLLAAVGPVDYATNYAKNAFDSLLKDVAAFALAHGLNARDVLVSGHSLGGLGVNSLAELSGANWGGFFKEANYVAFASPTQSATGNNVLNIGYENDPVFRALDGTTFSSGSLGKHDGHQDSATNNIVNFNDQYASTAQNLVPFSILNPLNWSAHGSLGYADGLNRVIDSRFYDLTDKDSTLIVSNLAEASRGKTWVEDLGRSGEPHTGSTFIIGTDSNDLLKGGAGNDFIEGRDGNDRFRDDGGYNLLLGGKGSNTFELQKPLQNFSVANDGDGTLYVRDAYGGISMTRDIGALVSKESGSWWGSKEVTYSVTANGLLNGSELTQYNHSLHGDAYGNTLAASVDGDWLFGNAGDDLLRSDKSQVTFVGGAGNDVMQASGGNNTFLFSGAFGFDVVNGYQSNDKLLFMGVQGAGQGYDYTQHASQSGHDTVLKIGDFAVTLVGVGLDNLSASGITFA
Wenjuan Yang et al. (2015) β€” Characterizing LipR from Pseudomonas sp. R0-14 and Applying in Enrichment of Polyunsaturated Fatty Acids from Algal Oil
Journal of Microbiology and Biotechnology  Β· doi:10.4014/jmb.1506.06011 β†—  Β· Stability - Incubation
20 measurements ▼
Database ID
UniProt: V5R5A9 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (20 measurements)

20 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 30% 100.0 36.2 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase tert-Butanol 30% 100.0 33.29 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase PEG-600 30% 100.0 21.03 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase PEG-400 30% 100.0 38.64 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 30% 100.0 49.88 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 30% 100.0 19.46 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 30% 100.0 77.36 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 30% 100.0 44.46 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100.0 26.37 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Glycerol 30% 100.0 19.42 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 15% 100.0 84.55 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase tert-Butanol 15% 100.0 77.71 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase PEG-600 15% 100.0 45.16 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase PEG-400 15% 100.0 63.6 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 15% 100.0 65.33 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 15% 100.0 50.51 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 15% 100.0 91.08 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 15% 100.0 62.18 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 15% 100.0 47.21 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Glycerol 15% 100.0 52.32 % Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol Incubation: ?, Assay: 8.5 Incubation: 60Β°C, Assay: 60Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*