Esterase (gene Est16) from a microbial consortium specialized for diesel oil degradation metagenomic library
Enzyme Description
Species
Na (microbial consortium specialized for diesel oil degradation metagenomic library)
Extremophile
No
EC Number
Sequence
MPQVQSNGITIEYESFGPADRETVLLIMGLGAQLTMWPVELCNELVARGYRAIRFDNRDVGLSTKFDAAGMPDMAAIFGALMSGKPASAPYSLDDMAADAVGLLDALGVKRAHIVGASMGGMIAQLVAINHPDRVLSLTSIMSTTGNPALPQGKPEAMAVLMTPAPEGDIEAAVARGINAWKVIGSPGFPTDDKILREWVTRDVRRSLYPVGVARQMAAIVANGDRREKLKNLDVPAVVLHGGDDPLVPVEGGKDTAANIPGAELIVVPGMGHDFPIALVKTFADAISKATARAGASKAAE
Mariana Rangel Pereira et al. (2015)
β Est16, a New Esterase Isolated from a Metagenomic Library of a Microbial Consortium Specializing in Diesel Oil Degradation
PLOS ONE
Β· doi:10.1371/journal.pone.0133723 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI00067A6E80 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (6 measurements)
6 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 2.5% | 100 | 89 | % | 50 mM Tris-HCl buffer, 0.3% triton X-100 | 8 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 2.5% | 100 | 111 | % | 50 mM Tris-HCl buffer, 0.3% triton X-100 | 8 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 5% | 100 | 93 | % | 50 mM Tris-HCl buffer, 0.3% triton X-100 | 8 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5% | 100 | 129 | % | 50 mM Tris-HCl buffer, 0.3% triton X-100 | 8 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 10% | 100 | 100 | % | 50 mM Tris-HCl buffer, 0.3% triton X-100 | 8 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100 | 122 | % | 50 mM Tris-HCl buffer, 0.3% triton X-100 | 8 | 30Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.