Esterase (gene Est16) from a microbial consortium specialized for diesel oil degradation metagenomic library

Enzyme Description

Species
Na (microbial consortium specialized for diesel oil degradation metagenomic library)
Extremophile
No
EC Number

Sequence

Length: 301 amino acids
MPQVQSNGITIEYESFGPADRETVLLIMGLGAQLTMWPVELCNELVARGYRAIRFDNRDVGLSTKFDAAGMPDMAAIFGALMSGKPASAPYSLDDMAADAVGLLDALGVKRAHIVGASMGGMIAQLVAINHPDRVLSLTSIMSTTGNPALPQGKPEAMAVLMTPAPEGDIEAAVARGINAWKVIGSPGFPTDDKILREWVTRDVRRSLYPVGVARQMAAIVANGDRREKLKNLDVPAVVLHGGDDPLVPVEGGKDTAANIPGAELIVVPGMGHDFPIALVKTFADAISKATARAGASKAAE
Mariana Rangel Pereira et al. (2015) β€” Est16, a New Esterase Isolated from a Metagenomic Library of a Microbial Consortium Specializing in Diesel Oil Degradation
PLOS ONE  Β· doi:10.1371/journal.pone.0133723 β†—  Β· Activity - Classical
6 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (6 measurements)

6 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 2.5% 100 89 % 50 mM Tris-HCl buffer, 0.3% triton X-100 8 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 2.5% 100 111 % 50 mM Tris-HCl buffer, 0.3% triton X-100 8 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 5% 100 93 % 50 mM Tris-HCl buffer, 0.3% triton X-100 8 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100 129 % 50 mM Tris-HCl buffer, 0.3% triton X-100 8 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 10% 100 100 % 50 mM Tris-HCl buffer, 0.3% triton X-100 8 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100 122 % 50 mM Tris-HCl buffer, 0.3% triton X-100 8 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*