Penicillin V acylase from Pectobacterium atrosepticum
Enzyme Description
Sequence
MIKNNKRIKSTVCALSLVALTLGSAVSLACTRFVYLDPHNPDYPITARSMDWADDTETNLWIFPQELKRSGGAGQYSLEWTSKYGSVIASAFDGRKGMASTTDGVNEKGLAANVLWLAESEYPKTKPTAKKPGLSVAAWAQYVLDNFATVDEAVKSLQQEKFILVTKQVEGQKRLATLHLSLSDSSGDSAIIEYIDGKQVIHHSKNYQVMTNSPTFDQQLTLNAYWDQIGGNVMLPGTNRAADRFVRASFYVKNVNPNKLIPGVAEKGKIEKDKADLATAFSIIRNASVPYGYSLPDMPNIASTRWRTVVDHKSLQYFFESAVSPNIFWVDLKKINFAPRGGSAAKLDLGPNQSTIYSGQASGHFKPAQPFEFAGL
V.S. Avinash et al. (2015)
β Penicillin V acylase from Pectobacterium atrosepticum exhibits high specific activity and unique kinetics
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2015.04.036 β
Β· Activity - Classical
▼
Database ID
UniProt: Q6D291 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21
Experimental Data (18 measurements)
18 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Methanol | 10% | 100.0 | 34.7 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100.0 | 27.8 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | n-Hexane | 10% | 100.0 | 77.1 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Ethyl Acetate | 10% | 100.0 | 59.7 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Acetonitrile | 10% | 100.0 | 81.4 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | 2-Butanone | 10% | 100.0 | 74.7 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Acetone | 10% | 100.0 | 103.4 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Isopropanol | 10% | 100.0 | 167.7 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Ethanol | 10% | 100.0 | 69.9 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Methanol | 5% | 100.0 | 74.9 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5% | 100.0 | 57.5 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | n-Hexane | 5% | 100.0 | 113.0 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Ethyl Acetate | 5% | 100.0 | 147.5 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Acetonitrile | 5% | 100.0 | 165.0 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | 2-Butanone | 5% | 100.0 | 174.0 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Acetone | 5% | 100.0 | 106.1 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Isopropanol | 5% | 100.0 | 194.6 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, p-dimethylaminobenzaldehyde (DMAB) and 6-aminopenicillanic acid reaction product absorbance measurement) in the presence of organic solvent | Ethanol | 5% | 100.0 | 82.0 | % | 100 mM acetate buffer | 5 | 45Β°C | 50 mM Penicillin V (Phenoxymethylpenicillin) | 6-aminopenicillanic acid , phenoxyacetic acid | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.