Lipase (gene lipA) from a marine sponge Ircinia sp. metagenomic library

Enzyme Description

Species
Na (marine sponge Ircinia sp. metagenomic library)
Extremophile
No but "alkaline-tolerant" enzyme
EC Number
3.1.1.3 β†—

Sequence

Length: 306 amino acids
MKKITTLYLCCLLFIFSNSANAGYTQTKYPIVLAHGLMGFDDVLGVDYFYRVPASLSRDGAQVFVTAVSSLNSSEQRGEQLLQQVEQIIALTGTTKVNLIGHSQGAQSIRYVASLRPDLVASATSVGGVNFGSPVADVVRQGLTPGSKLEGIAKTAFDAFGGLIALLSDNSQLPQDALGALESLTTEGALAFNQKYPEGLPAEQCQQGPMYASNGVYYFSWSGTRTLTNIFDPSDAALAITAILIPGDDDGLVSRCSSHLGYVLKDNYRMNHLDEVNQLIGFHHLFATDPLTVYRQHANRLKKLGL
Jing Su et al. (2015) β€” A new alkaline lipase obtained from the metagenome of marine sponge Ircinia sp.
World Journal of Microbiology and Biotechnology  Β· doi:10.1007/s11274-015-1859-5 β†—  Β· Activity - Classical
10 measurements ▼
Database ID
UniParc: UPI0002B26C01 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 15% 100.0 134.42 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 15% 100.0 31.41 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 15% 100.0 133.63 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 15% 100.0 142.31 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100.0 70.35 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30% 100.0 173.19 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30% 100.0 36.66 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 30% 100.0 97.63 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 30% 100.0 159.65 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100.0 66.67 % 50 mM Tris-HCl, 1 mM CaCl2, 0.3% Triton X 8 40Β°C 0.2 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Classical aqueous control (in %) | Disagreement betweent text and figure for assay pH

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*