Esterase (gene H9Est) from a TiΞ²n glacier metagenomic library

Enzyme Description

Species
Na (Tibetan glacier metagenomic library)
Extremophile
No but "psychrophilic", "halophilic" enzyme
EC Number

Sequence

Length: 356 amino acids
MTVNPPVLKSVMEKGQGTAARMLDRLPGIAQEALVKALDYPHVYPDLDPLVKCLMAIQIKQGHSSFISEDLAHSRTLFDARMKAIAAKPTTVKVIEELRLPLQSGSIFARHYHPAPQKKLPMVIFYHGGAFMVGGLDSHDEFCRLLAVHAKVQVLSVAYPLTPEFSPLQMVQVCEDALAWAHQHSKQLKIYKNRIAVAGDSAGGNLATVVAQRSAGKSYAARAQLLLYPAVDFKSRHPSFYAYKDGLVLSEQDIDLVTLMYAQTHQIELDDPLISPTYGELQNLPPSYVITARHDILHDEGSIYAHKLRQNGVAVHYDEYTDQAHGFINLTPISRRAKKYVIEISKNFRKFWDKNS
Concetta De Santi et al. (2015) β€” Identification and characterization of a novel salt-tolerant esterase from a Tibetan glacier metagenomic library
Biotechnology Progress  Β· doi:10.1002/btpr.2096 β†—  Β· Activity - Classical
20 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (20 measurements)

20 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 15% 100 44 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent PEG 20% 100 90 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent PEG 15% 100 91 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent PEG 10% 100 103 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent PEG 5% 100 107 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 20% 100 3 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 15% 100 21 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 10% 100 45 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 5% 100 73 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 20% 100 24 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 5% 100 43 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 10% 100 66 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 5% 100 83 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100 16 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100 30 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100 47 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100 76 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 20% 100 0 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 15% 100 2 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 10% 100 9 % 50 mM Tris-HCl buffer 8 40Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*