Esterase (gene H9Est) from a TiΞ²n glacier metagenomic library
Enzyme Description
Species
Na (Tibetan glacier metagenomic library)
Extremophile
No
but "psychrophilic", "halophilic" enzyme
EC Number
Sequence
MTVNPPVLKSVMEKGQGTAARMLDRLPGIAQEALVKALDYPHVYPDLDPLVKCLMAIQIKQGHSSFISEDLAHSRTLFDARMKAIAAKPTTVKVIEELRLPLQSGSIFARHYHPAPQKKLPMVIFYHGGAFMVGGLDSHDEFCRLLAVHAKVQVLSVAYPLTPEFSPLQMVQVCEDALAWAHQHSKQLKIYKNRIAVAGDSAGGNLATVVAQRSAGKSYAARAQLLLYPAVDFKSRHPSFYAYKDGLVLSEQDIDLVTLMYAQTHQIELDDPLISPTYGELQNLPPSYVITARHDILHDEGSIYAHKLRQNGVAVHYDEYTDQAHGFINLTPISRRAKKYVIEISKNFRKFWDKNS
Concetta De Santi et al. (2015)
β Identification and characterization of a novel salt-tolerant esterase from a Tibetan glacier metagenomic library
Biotechnology Progress
Β· doi:10.1002/btpr.2096 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI00042E38C1 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (20 measurements)
20 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 15% | 100 | 44 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | PEG | 20% | 100 | 90 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | PEG | 15% | 100 | 91 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | PEG | 10% | 100 | 103 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | PEG | 5% | 100 | 107 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 20% | 100 | 3 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 15% | 100 | 21 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 10% | 100 | 45 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 5% | 100 | 73 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 20% | 100 | 24 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 5% | 100 | 43 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 10% | 100 | 66 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 5% | 100 | 83 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20% | 100 | 16 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15% | 100 | 30 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100 | 47 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5% | 100 | 76 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 20% | 100 | 0 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 15% | 100 | 2 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 10% | 100 | 9 | % | 50 mM Tris-HCl buffer | 8 | 40Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.