Lipase (gene ylip9) from Yarrowia lipolytica MSR80

Enzyme Description

Species
Yarrowia lipolytica MSR80 β†—
Extremophile
No
EC Number
3.1.1.3 β†—

Sequence

Length: 412 amino acids
MYNGIAWEGYIYILGPFLKTRQHQKPQDTIMRLATIASFVGLVTASPIGLLPPALLNPFGPXXPDGTVAXAPLDVVHEMEHYWKYCSVSYCVGMXKNXQLYSQVKSPFVCNNILCADQEFSQTELLYSFYGINEHQTANGYLAADHKRKQLILVFRGTQSEADSAADLNTWQVSNVDFDGLKNSTDTNAESDCHGCSIHAGFVGIFNNSFKQIDSRLNLYKSMYPDYKLVVTGHSLGGAVALLYGVSLRINGRDPLVVTFGQPRVGNAAFASYVDSLFFPTAGDQLSSSPYRKMYRVTRYEDPVTQVPFWDGYTQQSGEVFINQFNVPTKPENVVFCQGQNNGFCANGIPWYQYANIDSDKQVHSSYFFRSPGCGGSQSFTPYGGNQTEPSAVSIPPGDLKARLNLPYDTNY
Poonam Syal et al. (2015) β€” Cloning, Expression, and Biochemical Characterization of an Enantioselective Lipase, YLIP9, from Yarrowia lipolytica MSR80
Applied Biochemistry and Biotechnology  Β· doi:10.1007/s12010-015-1561-y β†—  Β· Stability - Incubation
11 measurements ▼
Database ID
UniProt: V5N7Y3 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Bacillus subtilis HB101

Experimental Data (11 measurements)

11 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100.0 104.11 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 50% 100.0 100.0 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1,4-Dioxane 50% 100.0 168.63 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 50% 100.0 280.99 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 50% 100.0 238.25 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isopropanol 50% 100.0 295.25 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethyl Acetate 50% 100.0 100.0 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Butanol 50% 100.0 125.44 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Tetrahydrofuran (THF) 50% 100.0 208.89 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Petroleum Ether 50% 100.0 115.52 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Hexane 50% 100.0 132.85 % Incubation: ?, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.4 Incubation: Room temperature, Assay: 40Β°C 0.02 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*