Ξ±-amylase from Bacillus subtilis FP-133

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 614 amino acids
SVKNGTILHAWNWSFNTLTQNMKEIRDAGYAAIQTSPINQVKEGNQGDKSMRNWYWLYQPTSYQIGNRYLGTEQEFKDMCAAAEKYGVKVIVDAVINHTTSDYAAISDEIKRIPNWTHGNTQIKNWSDRWDVTQNSLLGLYDWNTQNTEVQTYLKRFLERALNDGADGFRYDAAKHIELPDDGNYGSRFWPNITNTSAEFQYGEILQDSASRDTAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSADKLVTWVESHDTYANDEEESTWMSDDDIRLGWAVIGSRSGSTPLFFSRPEGGGNGVRFPGKSQIGDRGSALFKDQAITAVNQFHNVMAGQPEELSNPNGNNQIFMNQRGSKGVVLANAGSSSVTVNTSTKLPDGRYDNRAGAGSFQVANGKLTGTINARSAAVLYSDDIGNAPHVFLENYQTGAVHSFNDQLTVTLRANAKTAKAVYQINNGQQTAFKDGDRLTIGKGDPIGTTYNIRLTGTNGEGAERTQEYTFVKKDQAQTNIIGYQNPDHWGQVNAYIYKHDGGRAIELTGSWPGKAMTKNANGIYTLTLPANADTANAKVIFNNGSAQVPGQNQPGFDYVQNGLYNNSGLNGYLPH
Shinji Takenaka et al. (2015) β€” Characterization of the native form and the carboxy-terminally truncated halotolerant form of Ξ±-amylases from Bacillus subtilis strain FP-133
Journal of Basic Microbiology  Β· doi:10.1002/jobm.201400813 β†—  Β· Activity - Classical
11 measurements
Database ID
Sequence Annotation
Explicit - Provided (45 first residues from the UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Bacillus subtilis RIK1285

Experimental Data (11 measurements)

11 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25% 100.0 88.9 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Dimethylformamide (DMF) 25% 100.0 6.3 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Methanol 25% 100.0 79.9 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Acetonitrile 25% 100.0 75.9 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Ethanol 25% 100.0 85.6 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Acetone 25% 100.0 101.4 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Isopropanol 25% 100.0 105.4 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent 1-Butanol 25% 100.0 96.9 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Chloroform 25% 100.0 0.1 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Benzene 25% 100.0 111.2 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Toluene 25% 100.0 123.2 % 50 mM sodium–potassium phosphate buffer 6.8 30Β°C 5 mg/mL Starch Reducing sugars β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*