Ξ±-amylase from Bacillus subtilis FP-133
Enzyme Description
Sequence
SVKNGTILHAWNWSFNTLTQNMKEIRDAGYAAIQTSPINQVKEGNQGDKSMRNWYWLYQPTSYQIGNRYLGTEQEFKDMCAAAEKYGVKVIVDAVINHTTSDYAAISDEIKRIPNWTHGNTQIKNWSDRWDVTQNSLLGLYDWNTQNTEVQTYLKRFLERALNDGADGFRYDAAKHIELPDDGNYGSRFWPNITNTSAEFQYGEILQDSASRDTAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSADKLVTWVESHDTYANDEEESTWMSDDDIRLGWAVIGSRSGSTPLFFSRPEGGGNGVRFPGKSQIGDRGSALFKDQAITAVNQFHNVMAGQPEELSNPNGNNQIFMNQRGSKGVVLANAGSSSVTVNTSTKLPDGRYDNRAGAGSFQVANGKLTGTINARSAAVLYSDDIGNAPHVFLENYQTGAVHSFNDQLTVTLRANAKTAKAVYQINNGQQTAFKDGDRLTIGKGDPIGTTYNIRLTGTNGEGAERTQEYTFVKKDQAQTNIIGYQNPDHWGQVNAYIYKHDGGRAIELTGSWPGKAMTKNANGIYTLTLPANADTANAKVIFNNGSAQVPGQNQPGFDYVQNGLYNNSGLNGYLPH
Shinji Takenaka et al. (2015)
β Characterization of the native form and the carboxy-terminally truncated halotolerant form of Ξ±-amylases from Bacillus subtilis strain FP-133
Journal of Basic Microbiology
Β· doi:10.1002/jobm.201400813 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A0P0YKS0 β
Sequence Annotation
Explicit - Provided (45 first residues from the UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Bacillus subtilis RIK1285
Experimental Data (11 measurements)
11 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 25% | 100.0 | 88.9 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 25% | 100.0 | 6.3 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Methanol | 25% | 100.0 | 79.9 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Acetonitrile | 25% | 100.0 | 75.9 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Ethanol | 25% | 100.0 | 85.6 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Acetone | 25% | 100.0 | 101.4 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Isopropanol | 25% | 100.0 | 105.4 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | 1-Butanol | 25% | 100.0 | 96.9 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Chloroform | 25% | 100.0 | 0.1 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Benzene | 25% | 100.0 | 111.2 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Toluene | 25% | 100.0 | 123.2 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.