C-terminal truncated Ξ±-amylase from Bacillus subtilis FP-133
Enzyme Description
Sequence
SVKNGTILHAWNWSFNTLTQNMKEIRDAGYAAIQTSPINQVKEGNQGDKSMRNWYWLYQPTSYQIGNRYLGTEQEFKDMCAAAEKYGVKVIVDAVINHTTSDYAAISDEIKRIPNWTHGNTQIKNWSDRWDVTQNSLLGLYDWNTQNTEVQTYLKRFLERALNDGADGFRYDAAKHIELPDDGNYGSRFWPNITNTSAEFQYGEILQDSASRDTAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSADKLVTWVESHDTYANDEEESTWMSDDDIRLGWAVIGSRSGSTPLFFSRPEGGGNGVRFPGKSQIGDRGSALFKDQAITAVNQFHNVMAGQPEELSNPNGNNQIFMNQRGSKGVVLANAGSSSVTVNTSTKLPDGRYDNRAGAGSFQVANGKLTGTINARSAAVLYSDDIGNAPHVFLENYQTGAVHSFNDQLTVTLRANAKTAKAVYQINNGQQTAFKDGDRLTIGKGDPIGTTYNIRLTGTNGEGAERTQEYTFVKKDQAQ
Shinji Takenaka et al. (2015)
β Characterization of the native form and the carboxy-terminally truncated halotolerant form of Ξ±-amylases from Bacillus subtilis strain FP-133
Journal of Basic Microbiology
Β· doi:10.1002/jobm.201400813 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A0P0YKS0 β
Sequence Annotation
Explicit - Provided (45 first residues and 99 last residues from the UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Bacillus subtilis RIK1285
Experimental Data (11 measurements)
11 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 25% | 100.0 | 94.9 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 25% | 100.0 | 13.8 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Methanol | 25% | 100.0 | 97.0 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Acetonitrile | 25% | 100.0 | 87.8 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Ethanol | 25% | 100.0 | 88.7 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Acetone | 25% | 100.0 | 115.3 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Isopropanol | 25% | 100.0 | 102.2 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | 1-Butanol | 25% | 100.0 | 104.3 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Chloroform | 25% | 100.0 | 0.1 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Benzene | 25% | 100.0 | 106.0 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Toluene | 25% | 100.0 | 113.0 | % | 50 mM sodiumβpotassium phosphate buffer | 6.8 | 30Β°C | 5 mg/mL Starch | Reducing sugars | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.