Protease from Geobacillus stearothermophilus B-1172

Enzyme Description

Species
Geobacillus stearothermophilus B-1172 β†—
Extremophile
Yes "thermophilic" organism
EC Number
3.4.21.62 β†—

Sequence

Length: 382 amino acids
MRGKKVWISLLFALALIFTMAFGSTSPAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVISEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAQAYAQSVPYGVSQIKAPALHSQGFTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSVGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIAYNMDVINMSLGGPSGSAALKAAVDKAVASGIVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVNSSNQRASFSSVGSELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDAFYYGKGLINVQAAAQ
Irfana Iqbal et al. (2014) β€” Purification and characterization of cloned alkaline protease gene of Geobacillus stearothermophilus
Journal of Basic Microbiology  Β· doi:10.1002/jobm.201400190 β†—  Β· Stability - Incubation
15 measurements ▼
Database ID
UniProt: A9YEC7 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (15 measurements)

15 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase 1-Butanol 10% 100 118 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase 1-Butanol 20% 100 129 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase 1-Butanol 30% 100 111 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Acetone 10% 100 103 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Acetone 20% 100 108 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Acetone 30% 100 114 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Isopropanol 10% 100 107 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Isopropanol 20% 100 103 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Isopropanol 30% 100 91 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Ethanol 10% 100 109 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Ethanol 20% 100 102 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Ethanol 30% 100 89 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Acetonitrile 10% 100 113 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Acetonitrile 20% 100 96 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at ?Β°C), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of Folin–Ciocalteu reagent and free fatty acids reaction product, 700 nm) in aqueous phase Acetonitrile 30% 100 77 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: ?, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*