Alkaline hydrolase PA27 from Pseudomonas aeruginosa MH38

Enzyme Description

Species
Pseudomonas aeruginosa MH38 β†—
Extremophile
No but "Organic Solvent-Stabe hydrolase"
EC Number
3.1.1.1 β†—

Sequence

Length: 249 amino acids
MHDLRQSGRLASGKAPVVEWSSHSERICPLPGAVMSEPLILDAPNADACIIWLHGLGADRTDFKPVAEALQMVLPSTRFILPQAPSQAVTVNGGWVMPSWYDILAFSPARAIDEDQLNASADQVIALIDEQRAKGIAAERIILAGFSQGGAVVLHTAFRRYAQPLGGVLALSTYAPTFDDLTLDERHKRIPVLHLHGSQDDVVDPALGRAAHDALQAQGVEVGWHDYPMGHEVSLEEIHDIGAWLRKRL
Eunjin Jang et al. (2014) β€” Identification, Characterization, and Immobilization of an Organic Solvent-Stable Alkaline Hydrolase (PA27) from Pseudomonas aeruginosa MH38
Molecules  Β· doi:10.3390/molecules190914396 β†—  Β· Stability - Incubation
8 measurements ▼
Database ID
UniParc: UPI0003DC47E9 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (8 measurements)

8 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase Acetone 30% 100 55 % Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: ? 10 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase Acetone 50% 100 7 % Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: ? 10 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase Isopropanol 30% 100 27 % Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: ? 10 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase Isopropanol 50% 100 5 % Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: ? 10 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase Benzene 30% 100 110 % Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: ? 10 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase Benzene 50% 100 108 % Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: ? 10 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase n-Hexane 30% 100 123 % Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: ? 10 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment, 405 nm) in aqueoous phase n-Hexane 50% 100 127 % Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: ? 10 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*