Lipase (gene RhLip) from Rhodococcus sp. AW25M09

Enzyme Description

Species

Rhodococcus sp. AW25M09 ↗

Extremophile

Yes "psychrophlic" organism, "alkaliphilic" enzyme

EC Number

3.1.1.1 ↗

Sequence

Length: 351 amino acids

MYRSNDSNDAANAVTGTYIDPAAEWTGPGARPLVVLAPGTQGQGDQCAPSKMLNNLITYTPPLGFMVEYEVLAAYSLLSQGYGVVITDYEGLGTPGAHTYVNRASEAHAVLDAARAAQKLQGTKISADGPVAAYGYSQGGGAAAAAAELAGEYAPEMNLVGTYAGAPPADLKQTLEQVDGTILTGVIGYTLNGLLNSDPDLQPIVDGNINDAGKAMLNLVADQCVGETILNVGLHRTNEYTKTGEPLSVVLDRLPRAQEILAKNKIGERTPNAPVLIQSGTSDDIVPHGQAVGLAGDWCGKGATVQLSAAQVPAIVPGSGAGHLIPDILGLGEAQNWIKDRFYGVPAPSNC

Concetta De Santi et al. (2014) — A New Alkaliphilic Cold-Active Esterase from the Psychrophilic Marine Bacterium Rhodococcus sp.: Functional and Structural Studies and Biotechnological Potential

Applied Biochemistry and Biotechnology · doi:10.1007/s12010-013-0713-1 ↗ · Activity - Classical

17 measurements ▼

Database ID

—

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (17 measurements)

17 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Diethyl Ether	20%	100	0	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethylformamide (DMF)	20%	100	33	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethylformamide (DMF)	15%	100	48	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethylformamide (DMF)	10%	100	56	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethylformamide (DMF)	5%	100	94	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	61	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100	76	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	130	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	108	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	3%	100	112	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Diethyl Ether	15%	100	0	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Diethyl Ether	10%	100	130	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Diethyl Ether	5%	100	229	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	20%	100	33	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	15%	100	37	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	10%	100	47	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	5%	100	69	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol , Pentanoic Acid	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Diethyl Ether	20%	100	0	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethylformamide (DMF)	20%	100	33	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethylformamide (DMF)	15%	100	48	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethylformamide (DMF)	10%	100	56	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethylformamide (DMF)	5%	100	94	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	61	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100	76	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	130	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	108	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	3%	100	112	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Diethyl Ether	15%	100	0	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Diethyl Ether	10%	100	130	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Diethyl Ether	5%	100	229	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	20%	100	33	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	15%	100	37	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	10%	100	47	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in the presence of organic solvent	Acetonitrile	5%	100	69	%	0.1 M CAPS buffer, 3% acetonitrile	10	30°C	0.1 mM p-Nitrophenyl valerate	p-Nitrophenol, Pentanoic Acid	—	—	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*