Papain from Carica papaya

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 345 amino acids
MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Mirtha M. Fernandez et al. (1991) β€” Papain kinetics in the presence of a water-miscible organic solvent
Biotechnology and Bioengineering  Β· doi:10.1002/bit.260371011 β†—  Β· Activity - Michaelis-Menten
20 measurements
Database ID
UniProt: P00784 β†—
Sequence Annotation
Inferred (change of numbering between article and UniProt)
Protein Source
Commercially purchased

Experimental Data (20 measurements)

20 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Michaelis-Menten kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 10%, 10% 82.0 92.7 1/s 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 50%, 50% 23.2 105.8 mM 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 40%, 40% 23.2 93.7 mM 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 30%, 30% 23.2 65.2 mM 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 20%, 20% 23.2 47.1 mM 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 10%, 10% 23.2 32.4 mM 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 50%, 50% 82.0 19.9 1/s 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 40%, 40% 82.0 30.4 1/s 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 30%, 30% 82.0 84.0 1/s 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 20%, 20% 82.0 89.5 1/s 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA 7.5 30Β°C ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride Ethanol , H+ , N-Benzoyl-L-arginine β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 10%, 10% 24.0 46.5 1/s 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 50%, 50% 3.7 50.6 mM 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 40%, 40% 3.7 43.3 mM 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 30%, 30% 3.7 24.3 mM 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 20%, 20% 3.7 24.6 mM 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 10%, 10% 3.7 9.1 mM 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 50%, 50% 24.0 11.7 1/s 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 40%, 40% 24.0 21.7 1/s 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 30%, 30% 24.0 30.7 1/s 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) 20%, 20% 24.0 45.7 1/s 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA 7.5 30Β°C ? mM Benzoyl-DL-arginine p-nitroanilide Benzoyl-DL-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in 1/s)

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*