Papain from Carica papaya
Enzyme Description
Sequence
MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Mirtha M. Fernandez et al. (1991)
β Papain kinetics in the presence of a water-miscible organic solvent
Biotechnology and Bioengineering
Β· doi:10.1002/bit.260371011 β
Β· Activity - Michaelis-Menten
▼
Database ID
UniProt: P00784 β
Sequence Annotation
Inferred (change of numbering between article and UniProt)
Protein Source
Commercially purchased
Experimental Data (20 measurements)
20 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Michaelis-Menten | kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 10%, 10% | 82.0 | 92.7 | 1/s | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 1/s) |
| Activity - Michaelis-Menten | Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 50%, 50% | 23.2 | 105.8 | mM | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 40%, 40% | 23.2 | 93.7 | mM | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 30%, 30% | 23.2 | 65.2 | mM | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 20%, 20% | 23.2 | 47.1 | mM | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Km (mM) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 10%, 10% | 23.2 | 32.4 | mM | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 50%, 50% | 82.0 | 19.9 | 1/s | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 1/s) |
| Activity - Michaelis-Menten | kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 40%, 40% | 82.0 | 30.4 | 1/s | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 1/s) |
| Activity - Michaelis-Menten | kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 30%, 30% | 82.0 | 84.0 | 1/s | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 1/s) |
| Activity - Michaelis-Menten | kcat (/s) measured by pH-stat (H+ reaction product titration with NaOH) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 20%, 20% | 82.0 | 89.5 | 1/s | 50 mM Tris-HCl buffer, 50 mM NaCl, 0.25 mM cysteine, 0.05 mM EDTA | 7.5 | 30Β°C | ? mM N-Ξ±-Benzoyl-L-arginine ethyl ester hydrochloride | Ethanol , H+ , N-Benzoyl-L-arginine | β | β | Classical aqueous control (in 1/s) |
| Activity - Michaelis-Menten | kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 10%, 10% | 24.0 | 46.5 | 1/s | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in 1/s) |
| Activity - Michaelis-Menten | Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 50%, 50% | 3.7 | 50.6 | mM | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 40%, 40% | 3.7 | 43.3 | mM | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 30%, 30% | 3.7 | 24.3 | mM | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 20%, 20% | 3.7 | 24.6 | mM | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 10%, 10% | 3.7 | 9.1 | mM | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 50%, 50% | 24.0 | 11.7 | 1/s | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in 1/s) |
| Activity - Michaelis-Menten | kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 40%, 40% | 24.0 | 21.7 | 1/s | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in 1/s) |
| Activity - Michaelis-Menten | kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 30%, 30% | 24.0 | 30.7 | 1/s | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in 1/s) |
| Activity - Michaelis-Menten | kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) , Dimethylformamide (DMF) | 20%, 20% | 24.0 | 45.7 | 1/s | 50 mM Tris-HCl buffer, 5 mM cysteine, 1 mM EDTA | 7.5 | 30Β°C | ? mM Benzoyl-DL-arginine p-nitroanilide | Benzoyl-DL-arginine , p-Nitroaniline | β | β | Classical aqueous control (in 1/s) |
Visualization : Activity β Michaelis-Menten
One bar per measurement. Colour = solvent, shade = solvent volume.