Lipase (UniProt : Q9RXH9) from Deinococcus radiodurans
Enzyme Description
Sequence
MGRSISTSRCSRREVAMNPVLRSAAVLSLTAVLAACGQTTPPIAAVSQTAPTPQITQAGQPQDSYAARRAALPAQAPEPLSGQLGASSLQQTYPGGQPLHAQVLNKSVPLILVHGLMGWGTDEMMGMPYWGGLYNVVGDLRGQGYTVSAASVGPISSNWERAAELFAQIKGGCVDYGAAYSARYGFNRFDKAKCYPGIYPQWDAAHPINLLGHSMGGQTSRMLVKLLEDGSPADADGNNLFRGGRVGWVKAVITVSTPNSGTPATDNLQAMVPVLKDLLKNAAAGLGVSSQSMVYDFDLGQWGLRRQAGESFDAYFDRVMASHFGKNDSNAAYDLSSDGSAELNQFIGRSTHTIYASWATSATSKGLVTGWAYPMPVMFAPLSALAWPYPWPMRQTIGNMTGSSPLGKVQYDASWWENDGLVPVKSQGAPLGQSEVAYAGGPVQPGQWYDLGKLSGWDHTAIVGIPGLQDVRPFYRNQAAWLASLP
Hua Shao et al. (2014)
β Thermostable lipases from extremely radioresistant bacterium Deinococcus radiodurans: Cloning, expression, and biochemical characterization
Journal of Basic Microbiology
Β· doi:10.1002/jobm.201300434 β
Β· Stability - Incubation
▼
Database ID
UniProt: Q9RXH9 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (4 measurements)
4 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | PEG-600 | 30% | 100.0 | 49.87 | % | Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol | Incubation: ?, Assay: 8 | Incubation: ?, Assay: 40Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Clear about assay in water |
| Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30% | 100.0 | 40.11 | % | Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol | Incubation: ?, Assay: 8 | Incubation: ?, Assay: 40Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Clear about assay in water |
| Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 30% | 100.0 | 1.4 | % | Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol | Incubation: ?, Assay: 8 | Incubation: ?, Assay: 40Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Clear about assay in water |
| Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 55.01 | % | Incubation: ?, Assay: 50 mM Tris-HCl, 4% Ethanol | Incubation: ?, Assay: 8 | Incubation: ?, Assay: 40Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Clear about assay in water |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.