Endo-Ξ²-1,4-mannanase (gene man5XZ3) from Aspergillus nidulans XZ3
Enzyme Description
Species
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MKRQALTLIPLLGAAAAQSGPYGQCGGNDWSGATTCVSGYVCVYQNEWYSQCVPGTATSSSTTLTTTTSATTRTTTTTTSTTSVPSSTNFPSASGLNFTIDGVTDYFAGSNSYWISMLTNDADVDLVLDHIASSGHKILRIWGFNDVNTEPSTGQVWFQKHQGGDAVVSSAEKRGIKLIINFVNNWDDYGGMSAYLNAYGGSTKTDWYTSATIQAAYRTYIKAVIDRFIDSPAIFAWELANEPRCNGCDTSILYDWIADTSAYIKSLDPLHMVCIGDEGFGLDEGSDGSYPFSYNEGLDFAANLAIDTIDFGTFHLYPGSWGVSYDWGNLWAITHGAACATAGKPCLFEEYGAPSDHCAIEVPWQTTAVSSTGIAGDLFWQWGDTLSTGQTHNDGNTIYYGSDEYTCMVTEHMERIAAR
Haiqiang Lu et al. (2013)
β A novel thermophilic endo-Ξ²-1,4-mannanase from Aspergillus nidulans XZ3: functional roles of carbohydrate-binding module and Thr/Ser-rich linker region
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-013-5112-6 β
Β· Activity - Classical
▼
Database ID
β
Sequence Annotation
Inferred
Protein Source
Recombinant, host yeast Pichia pastoris GS115
Experimental Data (2 measurements)
2 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Acetone | 40% | 100.0 | 149.5 | % | 100 mM McIlvaine buffer | 5 | 40Β°C | 0.5% (w/v) Locust bean gum | Reducing sugars | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent | Acetone | 60% | 100.0 | 155.9 | % | 100 mM McIlvaine buffer | 5 | 40Β°C | 0.5% (w/v) Locust bean gum | Reducing sugars | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.