Endo-Ξ²-1,4-mannanase (gene man5XZ3) from Aspergillus nidulans XZ3

Enzyme Description

Extremophile
Yes "thermophilic" organism
EC Number

Sequence

Length: 419 amino acids
MKRQALTLIPLLGAAAAQSGPYGQCGGNDWSGATTCVSGYVCVYQNEWYSQCVPGTATSSSTTLTTTTSATTRTTTTTTSTTSVPSSTNFPSASGLNFTIDGVTDYFAGSNSYWISMLTNDADVDLVLDHIASSGHKILRIWGFNDVNTEPSTGQVWFQKHQGGDAVVSSAEKRGIKLIINFVNNWDDYGGMSAYLNAYGGSTKTDWYTSATIQAAYRTYIKAVIDRFIDSPAIFAWELANEPRCNGCDTSILYDWIADTSAYIKSLDPLHMVCIGDEGFGLDEGSDGSYPFSYNEGLDFAANLAIDTIDFGTFHLYPGSWGVSYDWGNLWAITHGAACATAGKPCLFEEYGAPSDHCAIEVPWQTTAVSSTGIAGDLFWQWGDTLSTGQTHNDGNTIYYGSDEYTCMVTEHMERIAAR
Haiqiang Lu et al. (2013) β€” A novel thermophilic endo-Ξ²-1,4-mannanase from Aspergillus nidulans XZ3: functional roles of carbohydrate-binding module and Thr/Ser-rich linker region
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-013-5112-6 β†—  Β· Activity - Classical
2 measurements
Database ID
β€”
Sequence Annotation
Inferred
Protein Source
Recombinant, host yeast Pichia pastoris GS115

Experimental Data (2 measurements)

2 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Acetone 40% 100.0 149.5 % 100 mM McIlvaine buffer 5 40Β°C 0.5% (w/v) Locust bean gum Reducing sugars β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (DNS assay, 540 nm) in the presence of organic solvent Acetone 60% 100.0 155.9 % 100 mM McIlvaine buffer 5 40Β°C 0.5% (w/v) Locust bean gum Reducing sugars β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*