Lipase Lip2Pc from Psychrobacter cryohalolentis K5T

Enzyme Description

Species

Psychrobacter cryohalolentis K5T ↗

Extremophile

No but "psychrotrophic" organism

EC Number

3.1.1.3 ↗

Sequence

Length: 351 amino acids

MTLKPSLRAVLTPSAFLPSLGAIVTGALLMTMQATSAQAAGQYYNCANADGCQLVSSQYFTSDHTKTKYPVVLAHGMAGFTKMFGLVDYFYGIPETLMSGGSQVYTTKTSSFNNSEIRGEQLLQKIKTISAISGSPKVNLLGHSQGGIDIRYVAGVAPEYVASVTAIGSPEQGSKTADAVMRTLSEDSLATQAVSVFFQLFGGVTDVGSGTSPTELNKQEAWNTAVALSTDGAAKFNAKFPAAMPTSYCGQPTGTEANGIKYYSFSGVGQITNGLDPSDYMLALTGTSFDNDPNDGLVSACSSRLGYVIRDDYRMNHLDSANQLLGLTAWGQPDPKTLYRDQVNRLKKANL

Ksenia Novototskaya-Vlasova et al. (2013) — Expression and chaperone-assisted refolding of a new cold-active lipase from Psychrobacter cryohalolentis K5T

Protein Expression and Purification · doi:10.1016/j.pep.2013.07.011 ↗ · Stability - Incubation

10 measurements ▼

Database ID

UniParc: UPI0011F391DE ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (10 measurements)

10 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Acetonitrile	10%	100	102	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Ethanol	10%	100	105	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Methanol	10%	100	107	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100	107	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Dimethylformamide (DMF)	10%	100	103	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Acetonitrile	30%	100	2	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Ethanol	30%	100	95	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Methanol	30%	100	108	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	30%	100	117	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Dimethylformamide (DMF)	30%	100	101	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Acetonitrile	10%	100	102	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Ethanol	10%	100	105	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Methanol	10%	100	107	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100	107	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Dimethylformamide (DMF)	10%	100	103	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Acetonitrile	30%	100	2	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Ethanol	30%	100	95	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Methanol	30%	100	108	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	30%	100	117	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 5°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 415 nm) in aqueous phase	Dimethylformamide (DMF)	30%	100	101	%	Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 5°C, Assay: 25°C	0.1 mM p-Nitrophenyl decanoate	Decanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*