Protease P6 from Bacillus subtilis N7

Enzyme Description

Species

Extremophile

EC Number

3.4.- ↗

Sequence

Length: 264 amino acids

TKPYDDNGHGTHCAGDIASSGASSSGKYQGPAPEADLIGVKVLNKSGSGTLADIIEGVEWCIQYNKEHTKNPIRIISMSLGGDALRYDKETDDPLVKAVEKAWNEGIVVCVAAGNSGPEAQTISSPGVSEKVITVGAYDDNDTAGNEDDTVASFSSRGPTVYGKEKPDILAPGVDIVSLRSPRSYLDKLQKSNRVGSLYFSLSGTWMATPICAGIAALILQQNPQLSPDEVKTLIKQSPDQWTNEDPNIYGAGAVNAENAVPKE

Yi Luo et al. (2013) — Identification and characterization of an anti-fungi Fusarium oxysporum f. sp. cucumerium protease from the Bacillus subtilis strain N7

Journal of Microbiology · doi:10.1007/s12275-013-2627-6 ↗ · Stability - Incubation

4 measurements ▼

Database ID

UniProt: M4QCS3 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Purified, bacterium Bacillus subtilis N7

Experimental Data (4 measurements)

4 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (30 minutes at 60°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase	Acetone	25%	100	57	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9	Incubation: 60°C, Assay: 60°C	1% w/v Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about control
Stability - Incubation	Activity after incubation (30 minutes at 60°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase	1-Butanol	25%	100	71	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9	Incubation: 60°C, Assay: 60°C	1% w/v Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about control
Stability - Incubation	Activity after incubation (30 minutes at 60°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase	Ethanol	25%	100	76	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9	Incubation: 60°C, Assay: 60°C	1% w/v Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about control
Stability - Incubation	Activity after incubation (30 minutes at 60°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase	n-Hexane	25%	100	102	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9	Incubation: 60°C, Assay: 60°C	1% w/v Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about control

Stability - Incubation	Activity after incubation (30 minutes at 60°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase	Acetone	25%	100	57	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9	Incubation: 60°C, Assay: 60°C	1% w/v Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about control
Stability - Incubation	Activity after incubation (30 minutes at 60°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase	1-Butanol	25%	100	71	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9	Incubation: 60°C, Assay: 60°C	1% w/v Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about control
Stability - Incubation	Activity after incubation (30 minutes at 60°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase	Ethanol	25%	100	76	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9	Incubation: 60°C, Assay: 60°C	1% w/v Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about control
Stability - Incubation	Activity after incubation (30 minutes at 60°C), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 275 nm) in aqueous phase	n-Hexane	25%	100	102	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9	Incubation: 60°C, Assay: 60°C	1% w/v Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about control

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*