(S)-specific carbonyl reductase (gene SCR2) from Candida parapsilosis
Enzyme Description
Sequence
MGEIESYCNKELGPLPTKAPTLSKNVLDLFSLKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVRSKAYKCNISDPKSVEETISQQEKDFGTIDVFVANAGVPWTEGPEINVDNYDSWNKIINLDLNGVYYCAHTVGKIFKKNGKGSLVITSSMSGTIVNVPQLQAAYNAAKAACTHLTKSLAVEWAPFARVNCVSPGYIATEISDFVEKDMKAKWWQLTPLGREGLAQELVGAYLYLASNASTYTTGANLAVDGGYTCP
Zhong-Yu You et al. (2013)
β Characterization of a newly synthesized carbonyl reductase and construction of a biocatalytic process for the synthesis of ethyl (S)-4-chloro-3-hydroxybutanoate with high space-time yield
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-013-5042-3 β
Β· Stability - Incubation
▼
Database ID
UniProt: D5G304 β
Sequence Annotation
Inferred
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (16 measurements)
16 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Dimethylformamide (DMF) | 1% | 100.0 | 93.0 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Dimethylformamide (DMF) | 5% | 100.0 | 82.7 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 1% | 100.0 | 92.3 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 5% | 100.0 | 89.35 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | n-Hexane | 50% | 100.0 | 74.0 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Cyclohexane | 50% | 100.0 | 88.4 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | n-Heptane | 50% | 100.0 | 101.3 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Isooctane | 50% | 100.0 | 106.6 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | n-Dodecane | 50% | 100.0 | 93.4 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Ethyl Acetate | 50% | 100.0 | 22.2 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Butyl Acetate | 50% | 100.0 | 105.1 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Benzene | 50% | 100.0 | 84.8 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Toluene | 50% | 100.0 | 87.1 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Xylene | 50% | 100.0 | 86.0 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Dimethyl Phthalate | 50% | 100.0 | 131.5 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase | Petroleum Ether | 50% | 100.0 | 89.3 | % | Incubation: ?, Assay: 100 mM potassium phosphate buffer | Incubation: ?, Assay: 6 | Incubation: 25Β°C, Assay: 45Β°C | 2 mM Ethyl 4-chloroacetoacetate | Ethyl (3S)-4-chloro-3-hydroxybutanoate | 0.2 mM NADP | β | Non-incubated control (in %), activity measured in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.