Fructose-6-phosphate aldolase (gene fsaA) from Escherichia coli

Enzyme Description

Species
Escherichia coli β†—
Extremophile
No
EC Number
4.1.2.- β†—

Sequence

Length: 220 amino acids
MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
Martina Sudar et al. (2013) β€” Aldol addition of dihydroxyacetone to N-Cbz-3-aminopropanal catalyzed by two aldolases variants in microreactors
Enzyme and Microbial Technology  Β· doi:10.1016/j.enzmictec.2013.03.013 β†—  Β· Activity - Classical
36 measurements ▼
Database ID
UniProt: P78055 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli

Experimental Data (36 measurements)

36 measurements β€” page 1 of 2
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Acetonitrile 30% 0.76 β€” 0.19 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Ethyl Acetate 10% 0.67 β€” 0.43 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Ethyl Acetate 20% 0.67 β€” 0.18 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Ethyl Acetate 30% 0.67 β€” 0.13 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Ethyl Acetate 40% 0.67 β€” 0.08 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Ethyl Acetate 50% 0.67 β€” 0.06 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Acetonitrile 5% 0.76 β€” 0.76 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Acetonitrile 10% 0.76 β€” 0.6 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Acetonitrile 20% 0.76 β€” 0.35 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Ethyl Acetate 5% 0.67 β€” 0.67 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Acetonitrile 40% 0.76 β€” 0.08 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Acetonitrile 50% 0.76 β€” 0.01 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 5% 0.47 β€” 0.47 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 10% 0.47 β€” 0.36 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 20% 0.47 β€” 0.2 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 30% 0.47 β€” 0.14 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 40% 0.47 β€” 0.06 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution
A129S/A165G Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 50% 0.47 β€” 0.03 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) DMF content solution
A129S Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Acetonitrile 30% 4.0 β€” 1.2 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) acetonitrile content solution
A129S Activity - Classical Activity (in U*mg^-1) measured by HPLC in the presence of organic solvent Ethyl Acetate 10% 5.7 β€” 3.3 U/mg 50 mM TEA-HCl buffer 7.5 25Β°C 100 mM Dihydroxyacetone, 100 mM N-Cbz-3-aminopropanal 6-(N-Cbz-amino)-4-hydroxyhexan-2-one β€” 1000 rpm Classical aqueous control (in U/mg) with 5% organic solvent due to N-Cbz-3-aminopropanal low solubility in water | Control in low (5%) ethyl acetate content solution
β€Ή Prev
1 2
Next β€Ί

Mutations in this dataset (2)

A129S A129S/A165G

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*