Lipase (gene SMlipD) from a soil metagenomic library

Enzyme Description

Species
Na (soil metagenomic library)
Extremophile
No
EC Number
3.1.1.3 β†—

Sequence

Length: 359 amino acids
CAMSIAPFAGTTAVMTLATTHAAMAPTAPAAGYAATRYPIILEHGLSGTDKYAGVLEYWYGIQQDLQQNGAAVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLSSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQDVLAYDPTGLSSSVIAAFVNVFGILTSSSHNTNQDALAALQTLTTARAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTLSVFGVTGATDTSTLPLVDTDTSTLPLVDPANVLDLSTLALFGTGTVMINRGSGQNDGLVSKCSALFGKVLSTNYKWNHLDEINQLLGVRGAYAEDPVAVIRTHVNRLKLAGV
Mahejibin Khan et al. (2013) β€” Cloning and characterization of two functionally diverse lipases from soil metagenome
The Journal of General and Applied Microbiology  Β· doi:10.2323/jgam.59.021 β†—  Β· Stability - Incubation
4 measurements ▼
Database ID
UniParc: UPI000247BBE9 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli JM109

Experimental Data (4 measurements)

4 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase Isopropanol 50% 100 69 % Incubation: 50 mM sodium phosphate buffer, Assay: 1% acetonitrile, 4% Ethanol, 95% buffer Incubation: ?, Assay: 7.5 Incubation: Room temperature, Assay: 37Β°C 100 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” Incubation: 150 rpm Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was measured with or without organic solvent
Stability - Incubation Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 39 % Incubation: 50 mM sodium phosphate buffer, Assay: 1% acetonitrile, 4% Ethanol, 95% buffer Incubation: ?, Assay: 7.5 Incubation: Room temperature, Assay: 37Β°C 100 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” Incubation: 150 rpm Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was measured with or without organic solvent
Stability - Incubation Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase Methanol 50% 100 101 % Incubation: 50 mM sodium phosphate buffer, Assay: 1% acetonitrile, 4% Ethanol, 95% buffer Incubation: ?, Assay: 7.5 Incubation: Room temperature, Assay: 37Β°C 100 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” Incubation: 150 rpm Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was measured with or without organic solvent
Stability - Incubation Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase Xylene 50% 100 185 % Incubation: 50 mM sodium phosphate buffer, Assay: 1% acetonitrile, 4% Ethanol, 95% buffer Incubation: ?, Assay: 7.5 Incubation: Room temperature, Assay: 37Β°C 100 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” Incubation: 150 rpm Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was measured with or without organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*