Aldehyde reductase (gene ARD) from Sporobolomyces salmonicolor

Enzyme Description

Species
Sporobolomyces salmonicolor β†—
Extremophile
No
EC Number
1.1.1.2 β†—

Sequence

Length: 343 amino acids
MAKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDMLKQGAYDEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESDPQKSLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFNGEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSETA
Sakayu Shimizu et al. (1990) β€” Stereoselective Reduction of Ethyl 4-Chloro-3-Oxobutanoate by a Microbial Aldehyde Reductase in an Organic Solvent-Water Diphasic System
Applied and Environmental Microbiology  Β· doi:10.1128/aem.56.8.2374-2377.1990 β†—  Β· Stability - Incubation
9 measurements ▼
Database ID
UniProt: Q9UUN9 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, yeast Sporobolomyces salmonicolor

Experimental Data (9 measurements)

9 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (48 hours at 38Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Ethyl Acetate 50% 50.0 0.0 % Incubation: 100 mM potassium phosphate, 200 M NaCl, Assay: 100mM potassium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: 38Β°C, Assay: 30Β°C 3 Β΅mole in 3.13 ml Ethyl 4-chloroacetoacetate Ethyl (3R)-4-chloro-3-hydroxybutanoate 0.3 Β΅M in 3.13 ml NADPH Yes, "the mixture was shaken" incubation Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (48 hours at 38Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Butyl Acetate 50% 50.0 42.1 % Incubation: 100 mM potassium phosphate, 200 M NaCl, Assay: 100mM potassium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: 38Β°C, Assay: 30Β°C 3 Β΅mole in 3.13 ml Ethyl 4-chloroacetoacetate Ethyl (3R)-4-chloro-3-hydroxybutanoate 0.3 Β΅M in 3.13 ml NADPH Yes, "the mixture was shaken" incubation Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (48 hours at 38Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase 1-Octanol 50% 50.0 50.0 % Incubation: 100 mM potassium phosphate, 200 M NaCl, Assay: 100mM potassium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: 38Β°C, Assay: 30Β°C 3 Β΅mole in 3.13 ml Ethyl 4-chloroacetoacetate Ethyl (3R)-4-chloro-3-hydroxybutanoate 0.3 Β΅M in 3.13 ml NADPH Yes, "the mixture was shaken" incubation Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (48 hours at 38Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Chloroform 50% 50.0 35.0 % Incubation: 100 mM potassium phosphate, 200 M NaCl, Assay: 100mM potassium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: 38Β°C, Assay: 30Β°C 3 Β΅mole in 3.13 ml Ethyl 4-chloroacetoacetate Ethyl (3R)-4-chloro-3-hydroxybutanoate 0.3 Β΅M in 3.13 ml NADPH Yes, "the mixture was shaken" incubation Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (48 hours at 38Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Dichloromethane 50% 50.0 21.3 % Incubation: 100 mM potassium phosphate, 200 M NaCl, Assay: 100mM potassium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: 38Β°C, Assay: 30Β°C 3 Β΅mole in 3.13 ml Ethyl 4-chloroacetoacetate Ethyl (3R)-4-chloro-3-hydroxybutanoate 0.3 Β΅M in 3.13 ml NADPH Yes, "the mixture was shaken" incubation Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (48 hours at 38Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Carbon tetrachloride 50% 50.0 64.6 % Incubation: 100 mM potassium phosphate, 200 M NaCl, Assay: 100mM potassium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: 38Β°C, Assay: 30Β°C 3 Β΅mole in 3.13 ml Ethyl 4-chloroacetoacetate Ethyl (3R)-4-chloro-3-hydroxybutanoate 0.3 Β΅M in 3.13 ml NADPH Yes, "the mixture was shaken" incubation Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (48 hours at 38Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase 1,2-Dichloroethane 50% 50.0 39.2 % Incubation: 100 mM potassium phosphate, 200 M NaCl, Assay: 100mM potassium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: 38Β°C, Assay: 30Β°C 3 Β΅mole in 3.13 ml Ethyl 4-chloroacetoacetate Ethyl (3R)-4-chloro-3-hydroxybutanoate 0.3 Β΅M in 3.13 ml NADPH Yes, "the mixture was shaken" incubation Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (48 hours at 38Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Benzyl Chloride 50% 50.0 33.8 % Incubation: 100 mM potassium phosphate, 200 M NaCl, Assay: 100mM potassium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: 38Β°C, Assay: 30Β°C 3 Β΅mole in 3.13 ml Ethyl 4-chloroacetoacetate Ethyl (3R)-4-chloro-3-hydroxybutanoate 0.3 Β΅M in 3.13 ml NADPH Yes, "the mixture was shaken" incubation Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (48 hours at 38Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Diisopropyl Ether 50% 50.0 0.0 % Incubation: 100 mM potassium phosphate, 200 M NaCl, Assay: 100mM potassium phosphate buffer Incubation: ?, Assay: 6.5 Incubation: 38Β°C, Assay: 30Β°C 3 Β΅mole in 3.13 ml Ethyl 4-chloroacetoacetate Ethyl (3R)-4-chloro-3-hydroxybutanoate 0.3 Β΅M in 3.13 ml NADPH Yes, "the mixture was shaken" incubation Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*